DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and ATPSCKMT

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_954584.2 Gene:ATPSCKMT / 134145 HGNCID:27029 Length:233 Species:Homo sapiens


Alignment Length:191 Identity:90/191 - (47%)
Similarity:114/191 - (59%) Gaps:9/191 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NPLAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAFRRICLPYVPATTEQIQNVLSFLPK 74
            |.|.|      |..|.:|....||..:.:..|...||.||.|::|||:|||||:||:||:..| :
Human    29 NSLQK------SNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKML-R 86

  Fly    75 NSAGKLLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKF 139
            ...|.|:||||||||||:|||:.  ...|.|.|||||||:|||..|.|..|....:|:..||||.
Human    87 CRRGSLVDIGSGDGRIVIAAAKK--GFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKV 149

  Fly   140 DIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYD 200
            ....|:.||||||.|||..||.||..|...:.::||||||.|......:..:|::|||.||
Human   150 TFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 49/88 (56%)
ATPSCKMTNP_954584.2 Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 56..90 18/34 (53%)
AdoMet_MTases 83..>188 CDD:388410 54/107 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147638
Domainoid 1 1.000 164 1.000 Domainoid score I3937
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16780
Inparanoid 1 1.050 165 1.000 Inparanoid score I4193
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48183
OrthoDB 1 1.010 - - D1605787at2759
OrthoFinder 1 1.000 - - FOG0007117
OrthoInspector 1 1.000 - - oto89390
orthoMCL 1 0.900 - - OOG6_101641
Panther 1 1.100 - - LDO PTHR13610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4449
SonicParanoid 1 1.000 - - X5204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.