DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and XB5913776

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_002938227.3 Gene:XB5913776 / 100496633 XenbaseID:XB-GENE-5913777 Length:219 Species:Xenopus tropicalis


Alignment Length:174 Identity:61/174 - (35%)
Similarity:91/174 - (52%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GIGLSIVC--ASFVAPAFRRI----CLPYVPATTEQIQNVLSFLPKNSAGKLLDIGSGDGRIVVA 93
            ||..||..  |.||.|..|::    .:||:|:...|..|:|..| ....||.:|:||||||:|.:
 Frog    32 GITASIYAFWAVFVFPGIRKVPVSLRVPYLPSCKPQTANILKLL-NGREGKFVDLGSGDGRLVFS 95

  Fly    94 AAQHCGALKADGVELNPWLVYYSRLAALRHSVS-KRTRFFRRDLWKFDIKDYNFVVIFGVEQMMQ 157
            |...  .|:..|.||||.|:.:::..|....:| .:..|.:::.|:.|:..|..|.:|.....|:
 Frog    96 AVSL--GLQCTGYELNPILINWAKTLAWWRGISPNQATFLKQNFWEVDLSQYKNVTVFLAPNAME 158

  Fly   158 DLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYDL 201
            .||.||.||.|.:.::|.||||.|...|.......::.||.||:
 Frog   159 TLEKKLSAELPDDARVIVCRFPFPHWPHTCTEGASLDQVWAYDV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 32/89 (36%)
XB5913776XP_002938227.3 AdoMet_MTases 66..>175 CDD:418430 38/111 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.