DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and antkmt

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001002083.1 Gene:antkmt / 100000855 ZFINID:ZDB-GENE-040625-59 Length:213 Species:Danio rerio


Alignment Length:185 Identity:68/185 - (36%)
Similarity:101/185 - (54%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GGKILIAATGGVGIGLSIVCASFVAPAFRRICL----PYVPATTEQIQNVLSFLPKNSAGKLLDI 83
            ||..::..|...|:.:..|.|..:.|.|||:.|    ||:||:..|:.||:: |.|..:|.:.|:
Zfish    19 GGWQILQLTAATGLTVYAVWAGILMPGFRRVPLKLQVPYIPASKAQVSNVMT-LMKGRSGGIADL 82

  Fly    84 GSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKFDIKDYNFVV 148
            ||||||||:.|.:. |...|.|.|||||||..:...|.|....:...:.|.||||.|:..|..:.
Zfish    83 GSGDGRIVLEACRR-GFSPAVGYELNPWLVRLAHFHAWRAGHHRSVSYRREDLWKVDLSTYKNIT 146

  Fly   149 IFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYDLNK 203
            :|....::..|:.||:||.|.:..|:|.|||.|.....|:..:||:..|.|.:.:
Zfish   147 VFLAPSVLSLLQKKLLAELPEDALIVAGRFPFPDWTACKVEGEGVDRAWAYQIQE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 35/88 (40%)
antkmtNP_001002083.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101641
Panther 1 1.100 - - O PTHR13610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.