DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and ZMYND15

DIOPT Version :10

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_047292879.1 Gene:ZMYND15 / 84225 HGNCID:20997 Length:810 Species:Homo sapiens


Alignment Length:68 Identity:22/68 - (32%)
Similarity:29/68 - (42%) Gaps:16/68 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 AQFTQCPRCK-VRYCSEDCLMEAQKR-----YHRVAC--MGAFHS--------DDTHPINVLNET 136
            |:.|.||:|. |.||.|.||....:|     .||..|  :.||..        ..|:...|.:||
Human   391 AKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCPRLAAFMERAGELATLPFTYTAEVTSET 455

  Fly   137 WKK 139
            :.|
Human   456 FNK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 SET_SMYD5 3..366 CDD:380919 22/68 (32%)
zf-MYND 87..118 CDD:460312 14/35 (40%)
ZMYND15XP_047292879.1 zf-MYND 381..427 CDD:460312 14/35 (40%)
MSS51_C 552..746 CDD:466330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.