DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Smyd5 and ZMYND15

DIOPT Version :9

Sequence 1:	NP_650955.1	Gene:	Smyd5 / 42517	FlyBaseID:	FBgn0038869	Length:	393	Species:	Drosophila melanogaster
Sequence 2:	NP_001254751.1	Gene:	ZMYND15 / 84225	HGNCID:	20997	Length:	750	Species:	Homo sapiens

Alignment Length:	68	Identity:	22/68 - (32%)
Similarity:	29/68 - (42%)	Gaps:	16/68 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    88 AQFTQCPRCK-VRYCSEDCLMEAQKR-----YHRVAC--MGAFHS--------DDTHPINVLNET 136
            |:.|.||:|. |.||.|.||....:|     .||..|  :.||..        ..|:...|.:||
Human   323 AKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCPRLAAFMERAGELATLPFTYTAEVTSET 387

  Fly   137 WKK 139
            :.|
Human   388 FNK 390

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Smyd5	NP_650955.1	zf-MYND	87..118	CDD:280009	14/35 (40%)
Smyd5	NP_650955.1	SET	<296..333	CDD:279228
ZMYND15	NP_001254751.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	109..199
		zf-MYND	313..359	CDD:280009	14/35 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	565..590
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	709..750
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG2084
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900