powered by:
Protein Alignment Smyd5 and ZMYND15
DIOPT Version :9
Sequence 1: | NP_650955.1 |
Gene: | Smyd5 / 42517 |
FlyBaseID: | FBgn0038869 |
Length: | 393 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254751.1 |
Gene: | ZMYND15 / 84225 |
HGNCID: | 20997 |
Length: | 750 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 22/68 - (32%) |
Similarity: | 29/68 - (42%) |
Gaps: | 16/68 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 AQFTQCPRCK-VRYCSEDCLMEAQKR-----YHRVAC--MGAFHS--------DDTHPINVLNET 136
|:.|.||:|. |.||.|.||....:| .||..| :.||.. ..|:...|.:||
Human 323 AKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCPRLAAFMERAGELATLPFTYTAEVTSET 387
Fly 137 WKK 139
:.|
Human 388 FNK 390
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2084 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.