DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and Smyd3

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster


Alignment Length:362 Identity:76/362 - (20%)
Similarity:126/362 - (34%) Gaps:126/362 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLASDPKVEVPLLQHDPTAQWVAQFTQ 92
            |..|:||.   |.....|....||:|:...:.:                               :
  Fly    41 ILTEKPFA---FVLKSQYRLERCDNCLEATKVL-------------------------------K 71

  Fly    93 CPRCK-VRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINVLNETWKKMH--YPPETGSIM--LI 152
            |..|: |.||...|.|:|..: |:..|          |.      .||:|  ..|:...::  ||
  Fly    72 CSNCRYVSYCHRSCQMQAWGQ-HKHEC----------PF------LKKVHPRVVPDAARMLCRLI 119

  Fly   153 VRL-------MALYQQSTKKEEFLEQLQSFQSLIVNREQKIYHKMLGENFEQQMEQLYLAFCNAF 210
            :||       ...|.:...::  ...|.|..:.|.|...::.|          ::.|:       
  Fly   120 LRLEHGGDLIRGYYTEHGSRK--FRDLMSHYAEIKNDPMRLEH----------LDSLH------- 165

  Fly   211 TGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDSEKEQLDTVIDGLYAKVG 275
                                          :||:..:|   :.|.|...|.:|.::...|.....
  Fly   166 ------------------------------AVLTDMMA---ESPSTVPNKTELMSIYGRLITNGF 197

  Fly   276 EFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVVLKALAPIQ--QGEEICISYLDECM 338
            ......:|:..:.:||..|..:|||.|||.:||. .|::.| .|:..::  ...:|.|||:|   
  Fly   198 NILDAEMNSIATAIYLGVSITDHSCQPNAVATFE-GNELHV-HAIEDMECLDWSKIFISYID--- 257

  Fly   339 LERSRHSRHKVLRENYVFICQCPKCRAQASDPDETSE 375
            |..:...|...|:|:|.|:|.|.||    :|..|:.|
  Fly   258 LLNTPEQRRLDLKEHYYFLCVCSKC----TDAKESKE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 9/31 (29%)
SET <296..333 CDD:279228 13/38 (34%)
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 12/68 (18%)
TPR_12 377..440 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.