DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and CG18213

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650589.2 Gene:CG18213 / 42055 FlyBaseID:FBgn0038470 Length:879 Species:Drosophila melanogaster


Alignment Length:118 Identity:28/118 - (23%)
Similarity:46/118 - (38%) Gaps:25/118 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLASDPKVEVPLLQHD 81
            :.|:||.         ||...:.:..:.:...|||:..:.:|. ...|......||.|:.|:::.
  Fly   205 VQTENFV---------PFKGFKLTRKIPFASQACDYSEKSIEK-SGGVFASCDVPKGEIVLVENP 259

  Fly    82 PTAQWVAQFTQCPRCKVR--------------YCSEDCLMEAQKRYHRVACMG 120
            ...|:.|.|..|..|.|.              |||:.| |::....|:..|.|
  Fly   260 VYFQFSAPFLNCELCGVHQQQLYTCDNCRYRSYCSKSC-MKSDAEVHQYECYG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 11/44 (25%)
SET <296..333 CDD:279228
CG18213NP_650589.2 zf-MYND 271..309 CDD:280009 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.