DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and Smyd4-2

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:124/366 - (33%) Gaps:92/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELPGKGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLASDPK 72
            |...|||.::|.:.....:|:..|||..:   ....:|....|.||.:.|               
  Fly   260 ETKDKGRFVVANEGLRTGDVLLFEEPVAA---CLEPSYFGTHCHHCFKRL--------------- 306

  Fly    73 VEVPLLQHDPTAQWVAQFTQCPRCK-VRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINVLNET 136
                   |.|.:        |..|. :.:||..|:.||...|||..|                |.
  Fly   307 -------HTPVS--------CLHCSGIAFCSAQCMGEACSSYHRFEC----------------EY 340

  Fly   137 WKKMHYPPETGSIMLIVRLMAL--YQQSTKKEEFLEQLQ-SFQSLIVNREQK----IYHKMLGEN 194
            ...|     .||.|.|:..:||  :.|:...|:.|.... .|:.|..:.|.:    ...:.|...
  Fly   341 MDLM-----IGSGMSILCFIALRIFTQAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRRALMSG 400

  Fly   195 FEQQMEQLYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDSE 259
            |..::.|..|.|....|.   .:..|....:...|:||      ...||.....::....:|:..
  Fly   401 FLLRILQKSLYFGRRKTE---GVNPTAVELQVATALLG------LLQVLQYNAHQIYQTQVTEEH 456

  Fly   260 KEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPN-ACSTFPYSNDIVVLKALAPI 323
            :                |.|.......:|||...|..||.|.|: ||.   :....:||.|..|.
  Fly   457 R----------------FDGSKTVYLAAGLYGTGSYFNHECWPSTACH---FVGKKLVLTATRPH 502

  Fly   324 QQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKCR 364
            :..|.:.::| ....::.:...|.:.||..|.|.|.|..|:
  Fly   503 RANELVAVNY-GPIFIKNNLKERQRSLRGRYSFSCSCMACQ 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 10/31 (32%)
SET <296..333 CDD:279228 11/37 (30%)
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 16/68 (24%)
SET <474..513 CDD:279228 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.