DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and Smyd4-4

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster


Alignment Length:412 Identity:97/412 - (23%)
Similarity:147/412 - (35%) Gaps:102/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIRELPGKGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLAS 69
            |:||...:||.::..::.|..:::..||||.|...:   ...|..|..|.|      ||...|  
  Fly   188 ELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLT---PMRYIRCATCKR------ENYLTL-- 241

  Fly    70 DPKVEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHP-INVL 133
                 :|.             ..|  |...:|||:|...|.:.|||..|          | |:.|
  Fly   242 -----IPC-------------DSC--CSTMFCSEECKSIAMQTYHRYEC----------PIIDFL 276

  Fly   134 NETWKKMHYPPETGSIMLIVRLMAL--YQQSTKKEEFLEQLQ---------SFQSLIVNREQKIY 187
            |..:.|:|      .|.|...|:||  :....:..:|.||.|         ::..|......:..
  Fly   277 NRMFNKIH------CIALRTTLVALNIFPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAI 335

  Fly   188 HKMLGENFEQQMEQLYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGI--ATSVLSQWVAKV 250
            |.::.....:.:..|:.........:.|.|..||     :...|| ..:|:  .|.:|.:     
  Fly   336 HGLVTNQHLRSVSDLFQRSVVCAVLKHFIIEYTP-----VKEYLG-GEEGVNFFTDLLFR----- 389

  Fly   251 SDLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIV 315
             .|..:.|....:|     |..:|.|...:  ....||.|...|.|||||.||....  |.....
  Fly   390 -HLQTSPSNMHGID-----LVEQVNETKDD--QTHSSGAYAFLSLINHSCAPNTVRI--YEGTKA 444

  Fly   316 VLKALAPIQQGEEICISY---LDECMLERSRHSRHKVLRENYVFICQCPKCRA----------QA 367
            .:..|.||:.|..:..:|   ...|    |:..|.|.|...|.|.|:|..|..          :|
  Fly   445 YMFVLRPIKAGNVLYDNYGAHFAIC----SKEQRLKRLSLQYRFDCKCEGCELNYPMFGMMPHKA 505

  Fly   368 SDPDETSEDDDDDDEMDDYDDD 389
            :.|..|   ||.:..:..|:.|
  Fly   506 TVPSVT---DDTELALSSYNYD 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 10/30 (33%)
SET <296..333 CDD:279228 12/36 (33%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 17/67 (25%)
SET 363..463 CDD:279228 31/120 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.