DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and Smyd4-3

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster


Alignment Length:372 Identity:80/372 - (21%)
Similarity:130/372 - (34%) Gaps:103/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLASDPKVEVP 76
            :||...|:.:....|.:..|.||||....   .:....|::|.  :.||:               
  Fly   249 EGRFARASADVKPGEELLVERPFVSVLLE---KFAKTHCENCF--MRTVV--------------- 293

  Fly    77 LLQHDPTAQWVAQFTQCPRC-KVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINVLNETWKKM 140
                 |.|        |||| .|.||||.|..||.|:||:..|            .::...|:  
  Fly   294 -----PVA--------CPRCADVLYCSEQCREEASKKYHKYEC------------GIVPIIWR-- 331

  Fly   141 HYPPETGSIM---LIVRLMA-------LYQQSTKKEEFL-EQLQSFQSLIVNREQKIYHKMLGEN 194
                 :|:.:   :.:|::|       |..:.|..||.. |||.|.......|..:: .:..||.
  Fly   332 -----SGASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVAQL-ERHQGER 390

  Fly   195 -----FEQQMEQLYLAFC---NAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVS 251
                 |:..:...:|..|   ..:.|.|    ..||....:.:::..:.|.|..:     ..:|:
  Fly   391 QPSNFFQHVLMARFLTNCLRAGGYFGSE----PKPDEVSIICSLVLRSLQFIQFN-----THEVA 446

  Fly   252 DLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVV 316
            :|....|...:....|                  |..:|...:..||||.|.....|  ....:.
  Fly   447 ELHKFSSSGREKSIFI------------------GGAIYPTLALFNHSCDPGVVRYF--RGTTIH 491

  Fly   317 LKALAPIQQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKC 363
            :.::.||:.|..|..:| .....:..|..|...|::.|.|.|.|..|
  Fly   492 INSVRPIEAGLPINENY-GPMYTQDERSERQARLKDLYWFECSCDAC 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 15/31 (48%)
SET <296..333 CDD:279228 10/36 (28%)
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.