DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and SmydA-5

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster


Alignment Length:374 Identity:79/374 - (21%)
Similarity:133/374 - (35%) Gaps:115/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRAMIATKNFAKDEVIFEEEPFVSRQFSWNVA-----YGYAACDHCMRPLETVLENVRRLASDPK 72
            ||.:..|:|.|..:::|.|||.|... .|.::     .....|..|..|..              
  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGP-KWYLSDADKEASNVPCVGCYTPCR-------------- 104

  Fly    73 VEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINVLNETW 137
                |.:|           ||.||:...||..|..|:.:  ..|..:|: .|........||:.:
  Fly   105 ----LGKH-----------QCRRCRWPVCSAGCKHESME--CSVLSLGS-GSPTRADARSLNDYF 151

  Fly   138 KKMHYPPETGSIMLIVRLMALYQQSTKKEEFLEQLQSFQ------SLIVNREQKIYHKMLGENFE 196
            :        |..:|:::.:.|.:||..|...|.::||.:      .|....|:::. ..|.:.|.
  Fly   152 R--------GDALLVLKCLLLQRQSPTKWSALLEMQSHEEERKGTDLYEEAEKRVV-TYLQKRFL 207

  Fly   197 QQMEQL---YLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDS 258
            .:::|.   .|..|.            |:....|..|:.||..             |.:||    
  Fly   208 CRLKQTNPNLLTDCG------------PEMLHRLCGIIETNFM-------------VIELP---- 243

  Fly   259 EKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVVLKALAPI 323
                     .|:              |.|||:.....:.|:|.||....|......|.::|...:
  Fly   244 ---------SGV--------------ELSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDL 285

  Fly   324 QQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKCRAQASDPDE 372
            ::|:.:.|:|.:  :|..::..:|. ||....|.|:|.:|    .||.|
  Fly   286 RKGDHLRITYTN--ILWGTQLRQHH-LRLTKHFSCRCSRC----LDPTE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 9/30 (30%)
SET <296..333 CDD:279228 9/36 (25%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 29/162 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.