DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and dao

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster


Alignment Length:416 Identity:89/416 - (21%)
Similarity:134/416 - (32%) Gaps:117/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEIRELPGKGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLA 68
            |||..|.... ::..|:..||:.:|||.|. |:...|.|.    ..||:|               
  Fly   315 FEIAWLDNSS-SLHTTRAVAKNALIFESEA-VAMVPSGNC----RVCDYC--------------- 358

  Fly    69 SDPKVEVPLLQHDPTAQWVAQFT--QCPRCKVR---YCSEDCLMEAQKRYHRVACMGAFHSDDTH 128
                             .:.||.  .|..|..|   |||..|..: ....|.|.|.|       |
  Fly   359 -----------------GITQFIPFPCIYCSNRLVVYCSRQCRFK-HAAIHAVECFG-------H 398

  Fly   129 PINVLNETWKKMHYPPETGSI---MLIVRLMALYQQSTKKEEFLEQLQSFQSLIVNREQKIYHKM 190
            .|. |.|::.::...|....:   |||..|..|.....||....:...:....:..|:...|..:
  Fly   399 QIE-LFESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTLSKLWSAINGGLQERQDIAYSAV 462

  Fly   191 LGENFEQQMEQ-----------------LYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNS--- 235
            |  ..|:..|:                 :||:.|..|             |..|...|.|.|   
  Fly   463 L--RLERLKEERPTDTVIALALAAHILSIYLSKCTTF-------------FDQLEKSLPTASRMS 512

  Fly   236 ----QGIATSVLSQWVAKVSDLPLTDSEKEQLDTVIDGLYAKVGEF---AGEFLNNEGSGLYLLQ 293
                :.:..::|.:.:.::....||......| .....:::.:.||   |......||. |:||.
  Fly   513 SAEWELLCAALLMRHIGQLRHRSLTACRSFVL-PADPHVFSPLNEFQLWAAPMRLQEGH-LHLLA 575

  Fly   294 SKI---------------NHSCVPNACSTFPYSNDIVVLKALAPIQQGEEICISYLDECMLERSR 343
            .::               .|||....|:.|  |...|...||..:..|..|...:......:..|
  Fly   576 GEVAVVSYSVYPDTLNLCRHSCSSTICAKF--SGRTVTALALLDLPAGSGIYNCFAGGNFQQLPR 638

  Fly   344 HSRHKVLRENYVFICQCPKCRAQASD 369
            ..|.|.|.|:.: .|.|..|:...||
  Fly   639 EERTKQLLESGI-RCHCNACQLTHSD 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 11/35 (31%)
SET <296..333 CDD:279228 11/51 (22%)
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.