DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and set5

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:117 Identity:38/117 - (32%)
Similarity:58/117 - (49%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 TDSEKEQLDTVIDGLYAKVGEFAGEFLNN------EGSGLYLLQSKINHSCVPNACSTFPYSNDI 314
            |..|:|....:.:.....:|.|.|.|.:|      ...|::||.|::||.|.||...|:....|.
pombe    57 TKEEQEAFHRLFNAHPDTMGPFLGPFYSNALTIDETKGGMFLLGSRMNHDCSPNVKHTWNPRLDQ 121

  Fly   315 VVLKALAPIQQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKCRAQ 366
            |.:.|:..|:.||||..:|:|   |.:|...|.|:|.|::.|.|.|..|..:
pombe   122 VTVHAVRDIEAGEEILTTYID---LHKSHTERQKILLEHFGFKCYCSVCSVE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009
SET <296..333 CDD:279228 14/36 (39%)
set5NP_588413.1 SET <1..319 CDD:225491 38/117 (32%)
SET 4..147 CDD:214614 29/92 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005444
OrthoInspector 1 1.000 - - oto101510
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.