DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and set-10

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_493620.2 Gene:set-10 / 185237 WormBaseID:WBGene00009370 Length:430 Species:Caenorhabditis elegans


Alignment Length:289 Identity:62/289 - (21%)
Similarity:105/289 - (36%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CPRC-KVRYCSEDCLMEAQKRYHR-----VACMGAFHSDDTHPINVLNETWKKMHYPPETGSIML 151
            |..| .|.||:..|..:..|..|:     :.|.|:                    ..|.|.::.|
 Worm    41 CDDCLAVSYCTLKCQRKDWKSCHQFECEILRCQGS--------------------STPMTLTMKL 85

  Fly   152 IVRLMALYQQSTKKEEFLEQLQSFQSLIVNREQKIYHKMLGENFEQQMEQLYLAFCNAFTGEEFS 216
            .:|:: |..:||       |..||...::...:..|     :.|....|.      |.|..:..:
 Worm    86 CIRVL-LASRST-------QTPSFNGAVLEDLETNY-----KEFRSSPEH------NQFLSDVLT 131

  Fly   217 IFKT------PDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDSEKEQLDTVIDGLYAKVG 275
            |..:      |.:.:|...|      ||..|||....:.:::        ::::.:         
 Worm   132 IISSSGQNIFPTSLETNKTI------GIICSVLCNSFSIINE--------KRVEPI--------- 173

  Fly   276 EFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVVLKALAPIQQGEEICISYLDECMLE 340
                      |||||:..:|.||||.  :.|...:..:.|.|:.... :..:|:.|||:.. ||.
 Worm   174 ----------GSGLYVGVAKHNHSCA--STSHVVFEGNQVFLRTNQE-EYSKELTISYVSR-MLP 224

  Fly   341 RSRHSRHKVLRENYVFICQCPKCRAQASD 369
            .|  .|.|.:|..:...|||..|:.:..|
 Worm   225 TS--ERRKTIRGVHFLTCQCEMCKNEELD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 8/30 (27%)
SET <296..333 CDD:279228 9/36 (25%)
set-10NP_493620.2 zf-MYND 23..67 CDD:366792 8/25 (32%)
SET 57..247 CDD:394802 55/267 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.