DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd5 and set-30

DIOPT Version :9

Sequence 1:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 / 180772 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans


Alignment Length:344 Identity:80/344 - (23%)
Similarity:128/344 - (37%) Gaps:106/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLETVLENVRRLASDPKVEVPLLQHDPTAQWVAQFTQ---------------CPRCKV-RYCSED 104
            |||.|  .|.::.|.|:.:    :..|.|..:...|:               |.:||| ::||:.
 Worm     7 PLEVV--GVEKIGSKPRSK----EFYPFAYSLLDCTKDDYCWTCLGENVELTCEQCKVAKFCSKQ 65

  Fly   105 CLMEAQKRYHRVACMGAF-HSDDTHPINVLNETWKKMHYPPETGSIMLIVRLMALYQQSTKKEEF 168
            |           ...||. |..:..|:       ||.  |.......:::|::..|:.....:: 
 Worm    66 C-----------ETSGAIDHKYECGPL-------KKC--PDLNTDERMLIRIVGRYKDIHSGKD- 109

  Fly   169 LEQLQSFQSLIVNREQKIYHKMLGENFEQQMEQLYLAFCNAFTGEE---FSIFKTPDAFKTLMAI 230
                :|......|||.|   :.:.|.:|.         |.....:|   .|..||.|..|.    
 Worm   110 ----KSIDGFYNNRESK---RSVMEIWEH---------CADMKKDENAMKSFKKTYDRVKQ---- 154

  Fly   231 LGTNSQGIATSVLSQWVAKVSDLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSK 295
            .|..:..:...|..|..::      ....:..:..|             ::|...|.||||...|
 Worm   155 FGDTNHLMDEEVTFQLHSR------NFINRHSISNV-------------DYLREIGKGLYLDLCK 200

  Fly   296 INHSCVPNACSTFPYS-NDIVV-LKAL---APIQQGEEICISYLD--ECMLERSRHSRHKVLREN 353
            .:|||.|||.    || |.||. |:||   ..::..|....:|::  .|.::|    || :|:|.
 Worm   201 YDHSCRPNAI----YSCNGIVAKLRALHDNVDLENVETTHYTYIELPPCKIQR----RH-MLKET 256

  Fly   354 YVFICQCPKCRAQASDPDE 372
            :.|.|.|.:|    .|||:
 Worm   257 WYFECHCERC----DDPDD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 8/46 (17%)
SET <296..333 CDD:279228 15/41 (37%)
set-30NP_508850.2 zf-MYND 41..78 CDD:366792 10/47 (21%)
SET_SMYD <179..266 CDD:380997 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.