DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddrgk1 and Camsap1

DIOPT Version :10

Sequence 1:NP_650954.1 Gene:Ddrgk1 / 42516 FlyBaseID:FBgn0038868 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001394979.1 Gene:Camsap1 / 227634 MGIID:3036242 Length:1603 Species:Mus musculus


Alignment Length:118 Identity:45/118 - (38%)
Similarity:66/118 - (55%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EDEGQVDGDEARVPQGAVLDEKMGAKKRAKMEAKEQKRLQREQELH-DREQRKVKEAKEEAERKQ 152
            :::|:|.|.|:.|..|...|:|.|.....|.|.|.:..|.:::... .::|||.:||:   .|||
Mouse  1246 DEDGEVVGHESSVELGGDSDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEAR---ARKQ 1307

  Fly   153 QEDLEAEAERKRVDAERLAKEERERKEHE---------EYLKMKAAFSVEEEG 196
            |  ||||.|.||.:|.|.|:|:|.|||.|         |||:.|...::||:|
Mouse  1308 Q--LEAEVELKRDEARRKAEEDRLRKEEEKARRELIKQEYLRRKQQQALEEQG 1358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ddrgk1NP_650954.1 DDRGK 109..296 CDD:370664 38/98 (39%)
Camsap1NP_001394979.1 CAMSAP_CH 248..331 CDD:432229
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..419
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..490
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 785..823
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 841..886
CAMSAP_CC1 879..937 CDD:465344
Sufficient for interaction with SPTBN1. /evidence=ECO:0000250 887..908
Sufficient for interaction with calmodulin. /evidence=ECO:0000250 919..938
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1084..1163
wall_bind_EntB <1179..>1357 CDD:468642 43/115 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1245..1271 9/24 (38%)
ARGLU <1277..1354 CDD:405931 32/81 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1308..1335 16/28 (57%)
CAMSAP_CKK 1464..1592 CDD:198119
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.