DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and kdsD

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_417664.1 Gene:kdsD / 947734 ECOCYCID:G7662 Length:328 Species:Escherichia coli


Alignment Length:317 Identity:61/317 - (19%)
Similarity:106/317 - (33%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 KEARKLERETARRNEREAAKLEK-INRH----SEKISRSTERMAMAGVGSRSGSLERR------- 657
            ||...:|||.       .|:|:: ||::    .||:.....::.:.|:| :||.:.|:       
E. coli    17 KEVLAIEREC-------LAELDQYINQNFTLACEKMFWCKGKVVVMGMG-KSGHIGRKMAATFAS 73

  Fly   658 -------------------------------RSGEDS------PVLNQSTVHGIASPNRRPTIFD 685
                                           .|||.|      |||.:..|         |.|..
E. coli    74 TGTPSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEITALIPVLKRLHV---------PLICI 129

  Fly   686 VFRPRAKSDAKRQKEKHLLDPSS--------ADSSATSSTYSVSGGTGPATSSAAGGAGGAAAAA 742
            ..||  :|...|..:.||....:        |.:|:|::|..:......|...|.|......|.:
E. coli   130 TGRP--ESSMARAADVHLCVKVAKEACPLGLAPTSSTTATLVMGDALAVALLKARGFTAEDFALS 192

  Fly   743 GQGAAGGAGGLMN------------------SMKVAMQNFSHRQHPAVTITSADGTQSTAKSKYK 789
            ..|.|.|...|:.                  |::.|:...: |::..:|:...|...  .:..:.
E. coli   193 HPGGALGRKLLLRVNDIMHTGDEIPHVKKTASLRDALLEVT-RKNLGMTVICDDNMM--IEGIFT 254

  Fly   790 DGSAHP--HQGSDAQYYHTVTAVRPNSSQRSP---MTKVMDLF--RHRSSSVVSEAD 839
            ||....  ..|.|.:.......:.|...:..|   ..:.::|.  ||.:|.:|::.|
E. coli   255 DGDLRRVFDMGVDVRQLSIADVMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990
CBS 952..1067 CDD:223591
CBS 1023..1141 CDD:223591
CBS_pair_28 1097..1215 CDD:240012
CBS 1097..1213 CDD:223591
kdsDNP_417664.1 PRK10892 3..328 CDD:182814 61/317 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0517
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.