DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and CBSX6

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_176711.1 Gene:CBSX6 / 842840 AraportID:AT1G65320 Length:425 Species:Arabidopsis thaliana


Alignment Length:412 Identity:88/412 - (21%)
Similarity:137/412 - (33%) Gaps:135/412 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   928 FRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLW---------------DSEKQQF 977
            |.:|...||.....::|.|.....|:.|..|:..:.....|:|               :..:|:|
plant     5 FLYHVVGDLTVGKPEMVEFYETETVESAIRAIGESTECGIPVWRKRTTPSLPGFVENSEMRQQRF 69

  Fly   978 VGMLTITDFIKILQMYYKSPNASMEQLEEHKLDTWRSVLHNQVMP----LVSIGPDASLYDAIKI 1038
            ||:|...|.:..|        |..|.|:|.|  ..:..:...|.|    |..:.|...|.||:: 
plant    70 VGILNSLDIVAFL--------AKTECLQEEK--AMKIPVSEVVSPDNTLLKQVDPGTRLIDALE- 123

  Fly  1039 LIHSRIHRLPVIDPATGNVLYILTHKRIL------RFLFLYINELPKPAYMQKSLRELKIGTYNN 1097
            ::...:.||             |..|.::      ||..||..:..|.:....|...|...:.|.
plant   124 MMKQGVRRL-------------LVPKSVVWRGMSKRFSILYNGKWLKNSENSSSSSGLSADSTNR 175

  Fly  1098 IETADETTSIITALKKF--------------VERRVSALPLVDSDGRLVDIYAKFDVINLAAEKT 1148
                 .|||:.::..||              |...::.|||..        .:...:||    :.
plant   176 -----PTTSMTSSRDKFCCLSREDVIRFLIGVLGALAPLPLTS--------ISTLGIIN----QN 223

  Fly  1149 YNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLS--- 1210
            ||.::.||..        .|..::...|.|...::|:...         ::..|:||.||.|   
plant   224 YNFIEASLPA--------IEATRRPLCDPSAIAVLEQTEN---------EQQFKIIGEISASKLW 271

  Fly  1211 --DIL--------LYLVLRPSGEGVGGSE---SSLRASDPVLLRKVAEVEIPATAAAATTTTP-- 1260
              |.|        ||     :|:.|.|.|   ||...||      ..:...|......|.|..  
plant   272 KCDYLAAAWALANLY-----AGQFVMGVEDNMSSRSFSD------FLQTSFPGGEQNGTATNAKK 325

  Fly  1261 ---------PRSPSAGSGNRSL 1273
                     |.||:..|..||:
plant   326 FSSRSIGFNPTSPTRLSIGRSM 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 30/152 (20%)
CBS 952..1067 CDD:223591 28/133 (21%)
CBS 1023..1141 CDD:223591 26/137 (19%)
CBS_pair_28 1097..1215 CDD:240012 27/144 (19%)
CBS 1097..1213 CDD:223591 26/134 (19%)
CBSX6NP_176711.1 CBS_pair 24..134 CDD:301603 26/133 (20%)
CBS <68..134 CDD:223591 20/89 (22%)
CBS 351..402 CDD:278968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.