DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and AT5G53750

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_200186.2 Gene:AT5G53750 / 835456 AraportID:AT5G53750 Length:408 Species:Arabidopsis thaliana


Alignment Length:254 Identity:47/254 - (18%)
Similarity:89/254 - (35%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 VGMLTITDFIKILQMYYKSPNASMEQLEEHKLDTWRSVLHNQVMPLVSIGPDASLYDAIKILIHS 1042
            :|::..|..|..:. ||.|..:::..:.       |::|.|..:.:|..|.|..  |...:||..
plant   200 LGVINSTHTILAVD-YYSSAASAVSAIS-------RAILDNVSVAVVGKGCDQE--DPCMVLIGE 254

  Fly  1043 RIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSI 1107
                   |.|.|                ....:|....|....|..:|    .:.|:.:....|:
plant   255 -------ISPMT----------------LACCDETAVAAVATLSAGDL----MSYIDGSGPPESL 292

  Fly  1108 ITALKKFVERR--VSALPLVDS----------------DGRLVDIYAKFDVINLAAEKTYNDLDV 1154
            :..::..:|.:  |..:.|:||                ..|:...|.:  .::.||......:.:
plant   293 VGVVRNRLEDKGMVGLISLIDSLSLSSGSSSDEESPAGKTRMTSSYGR--SVSSAARMARKSVAI 355

  Fly  1155 SLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDIL 1213
                             .||...||..:|.:.:...|..:.|:||:..:||:::..|||
plant   356 -----------------VCNRKSSLMAVMIQAIAHRVSYVWVIDEDGCLIGMVTFVDIL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 18/90 (20%)
CBS 952..1067 CDD:223591 18/88 (20%)
CBS 1023..1141 CDD:223591 22/135 (16%)
CBS_pair_28 1097..1215 CDD:240012 25/135 (19%)
CBS 1097..1213 CDD:223591 23/133 (17%)
AT5G53750NP_200186.2 CBS 355..399 CDD:366174 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.