DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and CBSX3

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_196647.1 Gene:CBSX3 / 830953 AraportID:AT5G10860 Length:206 Species:Arabidopsis thaliana


Alignment Length:151 Identity:32/151 - (21%)
Similarity:61/151 - (40%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1029 DASLYDAIKILIHSRIHRLPVIDPATGNVLY-ILTHKRILRFLFLYINELPKPAYMQKSLRELKI 1092
            |.::|||:|.:....:..|.|:.|.....|. |:|.:..||          |.....:|.:..|:
plant    78 DDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLR----------KIIVQGRSSKSTKV 132

  Fly  1093 GTY----NNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLD 1153
            |..    |.:.|....|.::.|::...:.|:..:|::...| ::.:.:..||:...         
plant   133 GDIMTEENKLITVTPETKVLRAMQLMTDNRIRHIPVIKDKG-MIGMVSIGDVVRAV--------- 187

  Fly  1154 VSLRKANEHRNEWFEGVQKCN 1174
                 .:|||.|    :|:.|
plant   188 -----VHEHREE----LQRLN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 12/40 (30%)
CBS 952..1067 CDD:223591 11/38 (29%)
CBS 1023..1141 CDD:223591 25/116 (22%)
CBS_pair_28 1097..1215 CDD:240012 14/78 (18%)
CBS 1097..1213 CDD:223591 14/78 (18%)
CBSX3NP_196647.1 CBS_pair_bac_euk 75..185 CDD:341391 26/117 (22%)
CBS repeat 75..136 CDD:341391 17/67 (25%)
CBS repeat 143..185 CDD:341391 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.