DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and CBSX3

DIOPT Version :10

Sequence 1:NP_732598.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_196647.1 Gene:CBSX3 / 830953 AraportID:AT5G10860 Length:206 Species:Arabidopsis thaliana


Alignment Length:151 Identity:32/151 - (21%)
Similarity:61/151 - (40%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1029 DASLYDAIKILIHSRIHRLPVIDPATGNVLY-ILTHKRILRFLFLYINELPKPAYMQKSLRELKI 1092
            |.::|||:|.:....:..|.|:.|.....|. |:|.:..||          |.....:|.:..|:
plant    78 DDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLR----------KIIVQGRSSKSTKV 132

  Fly  1093 GTY----NNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLD 1153
            |..    |.:.|....|.::.|::...:.|:..:|::...| ::.:.:..||:...         
plant   133 GDIMTEENKLITVTPETKVLRAMQLMTDNRIRHIPVIKDKG-MIGMVSIGDVVRAV--------- 187

  Fly  1154 VSLRKANEHRNEWFEGVQKCN 1174
                 .:|||.|    :|:.|
plant   188 -----VHEHREE----LQRLN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_732598.1 CBS_euAMPK_gamma-like_repeat1 932..1068 CDD:341388 11/39 (28%)
CBS repeat 940..1013 CDD:341388
CBS repeat 1024..1068 CDD:341388 11/39 (28%)
CBS_euAMPK_gamma-like_repeat2 1094..1217 CDD:341399 15/85 (18%)
CBS repeat 1095..1160 CDD:341399 9/68 (13%)
CBS repeat 1171..1214 CDD:341399 2/4 (50%)
CBSX3NP_196647.1 CBS_pair_bac_euk 75..185 CDD:341391 26/117 (22%)
CBS repeat 75..136 CDD:341391 17/67 (25%)
CBS repeat 143..185 CDD:341391 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.