DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and LEJ2

DIOPT Version :10

Sequence 1:NP_732598.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_195409.1 Gene:LEJ2 / 829844 AraportID:AT4G36910 Length:236 Species:Arabidopsis thaliana


Alignment Length:211 Identity:47/211 - (22%)
Similarity:88/211 - (41%) Gaps:61/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1046 RLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITA 1110
            |:|....|.|:.|  :|:....|.....:.|     :|.|.         .::.....||::..|
plant    51 RIPSASSAAGSTL--MTNSSSPRSGVYTVGE-----FMTKK---------EDLHVVKPTTTVDEA 99

  Fly  1111 LKKFVERRVSALPLVDSDGRLVDIYAKFDVINL------------------AAEKTYNDLDVSLR 1157
            |:..||.|::..|::|.|.:||.:.:.:|::.|                  :..||:|.:...|.
plant   100 LELLVENRITGFPVIDEDWKLVGLVSDYDLLALDSISGSGRTENSMFPEVDSTWKTFNAVQKLLS 164

  Fly  1158 KANEHRNEWFEG--------------VQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIIS 1208
            |.|        |              .:|.||:::...::|    .:..||.|||.:.|::|||:
plant   165 KTN--------GKLVGDLMTPAPLVVEEKTNLEDAAKILLE----TKYRRLPVVDSDGKLVGIIT 217

  Fly  1209 LSDIL-LYLVLRPSGE 1223
            ..::: ..|.::.||:
plant   218 RGNVVRAALQIKRSGD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_732598.1 CBS_euAMPK_gamma-like_repeat1 932..1068 CDD:341388 6/21 (29%)
CBS repeat 940..1013 CDD:341388
CBS repeat 1024..1068 CDD:341388 6/21 (29%)
CBS_euAMPK_gamma-like_repeat2 1094..1217 CDD:341399 34/155 (22%)
CBS repeat 1095..1160 CDD:341399 19/82 (23%)
CBS repeat 1171..1214 CDD:341399 13/43 (30%)
LEJ2NP_195409.1 CBS_pair_plant_CBSX 83..224 CDD:341425 35/161 (22%)
CBS repeat 84..175 CDD:341425 21/107 (20%)
CBS repeat 180..223 CDD:341425 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.