DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and CBSX5

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_194476.2 Gene:CBSX5 / 828855 AraportID:AT4G27460 Length:391 Species:Arabidopsis thaliana


Alignment Length:351 Identity:77/351 - (21%)
Similarity:124/351 - (35%) Gaps:98/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 VGMLTITDFIKILQMYYKSPNASMEQLEEHKLDTWRS-VLHNQVMPLVSIGPDASLYDAIKILIH 1041
            :|.:::.|.|..|...:.....::.......|...|| |||.|        |..||.:||.::|.
plant    63 LGKISMADVICHLSKDHDHSLCALNSSVSVLLPKTRSIVLHVQ--------PSCSLIEAIDLIIK 119

  Fly  1042 SR------IHRLP--------------VIDPATGNVLYILTHKRILRFLFLYINEL-PKPAYMQK 1085
            ..      ||..|              ....:.|.....:|.:.|::||..:|... |.||   .
plant   120 GAQNLIVPIHTKPYTKKKQHNDNVSVTTTTHSNGQRFCWITQEDIIQFLLGFIAAFSPLPA---M 181

  Fly  1086 SLRELKIGTYNNIETA------DETTSIITALKKFVERRVSALPLVDSDG--RLVDIYAKFDVIN 1142
            ||.:|  |..|:..|.      ...:::::|:...:..:.| :.:||.:|  ....:..:...:.
plant   182 SLSDL--GVINSTHTVVAVDYHSSASAVVSAVSNALAVQTS-VAVVDGEGDDPFTSLIGEISPMT 243

  Fly  1143 LAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGII 1207
            |    |..|...:...|.....:....:...|..|||.    :|||   :||    |::.:||::
plant   244 L----TCCDETAAAAVATLSAGDLMAYIDGANPPESLV----QIVR---NRL----EDKGLIGLM 293

  Fly  1208 SLSDILLYLVLRPSGEGVGGSESSLRASDPVLLRKVAEVEIPATAAAATTTTPPRSPSAGSGNRS 1272
            ||.|.|       |........||             |.|.|     ..||:..||.|:.:    
plant   294 SLFDSL-------SSYSTSSGYSS-------------EEEAP-----VRTTSYGRSMSSSA---- 329

  Fly  1273 LIEDIPEEETAPARSDDADSDNNKSA 1298
                      ..||..:|...|.||:
plant   330 ----------RMARKSEAIVCNPKSS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 23/111 (21%)
CBS 952..1067 CDD:223591 22/109 (20%)
CBS 1023..1141 CDD:223591 29/146 (20%)
CBS_pair_28 1097..1215 CDD:240012 26/125 (21%)
CBS 1097..1213 CDD:223591 25/123 (20%)
CBSX5NP_194476.2 CBS_pair <336..382 CDD:301603 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.