DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and SETH3

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_191029.1 Gene:SETH3 / 824634 AraportID:AT3G54690 Length:350 Species:Arabidopsis thaliana


Alignment Length:168 Identity:36/168 - (21%)
Similarity:64/168 - (38%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1059 YILTHK--RILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSA 1121
            |...|.  ||.:.|...:.:      :.|...||.:        ..|...|:..|.:...:....
plant   208 YAANHPAGRIGKSLIFKVKD------VMKKQEELPV--------CKEGDLIMDQLVELTSKGCGC 258

  Fly  1122 LPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNL------DESLY 1180
            |.:||...||:..:            |..||..:|:.:.|...:...| :.||.      .|:: 
plant   259 LLVVDEHSRLIGTF------------TDGDLRRTLKASGEAIFKLSVG-EMCNRKPRTIGPETM- 309

  Fly  1181 TIMERIVRAE-----VHRLVVVDENRKVIGIISLSDIL 1213
             .:|.:.:.|     |..|.||:|:..:|||::|..::
plant   310 -AVEAMKKMESPPSPVQFLPVVNEDNTLIGIVTLHGLV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 4/11 (36%)
CBS 952..1067 CDD:223591 3/9 (33%)
CBS 1023..1141 CDD:223591 16/83 (19%)
CBS_pair_28 1097..1215 CDD:240012 28/128 (22%)
CBS 1097..1213 CDD:223591 28/126 (22%)
SETH3NP_191029.1 gutQ 62..350 CDD:183186 36/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.