DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and Clcn6

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:NP_036059.1 Gene:Clcn6 / 26372 MGIID:1347049 Length:870 Species:Mus musculus


Alignment Length:319 Identity:65/319 - (20%)
Similarity:103/319 - (32%) Gaps:117/319 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   937 IPTSAKLVVFD-TQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNAS 1000
            :|....|:|.. |..|..|..|. |:.|:|..||.:.|....:..|..:|.:: ..:.|..|   
Mouse   556 LPIMVTLMVAKWTGDLFNKGIYD-VHIGLRGVPLLEWETDVEMDKLRASDIME-PNLTYVYP--- 615

  Fly  1001 MEQLEEHKLDTWRSVLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKR 1065
                            |.::..||||         ::..:|   |..||:....||      .|.
Mouse   616 ----------------HTRIQSLVSI---------LRTTVH---HAFPVVTENRGN------EKE 646

  Fly  1066 ILRFLFLYINEL--PKPAYMQKSLRELKIG----TYNNIE---------TADETTSIITALKKFV 1115
            .::...|..|.:  .|.:.:.::..:.|.|    :|.:.|         .::|.......|::.:
Mouse   647 FMKGNQLISNNIKFKKSSILTRAGEQRKRGQSMKSYPSSELRNVCDEHVASEEPAEKEDLLQQML 711

  Fly  1116 ERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLY 1180
            |||.:..|                  ||     |.|...|        .:|              
Mouse   712 ERRYTPYP------------------NL-----YPDQSPS--------EDW-------------- 731

  Fly  1181 TIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGVGGSESSLRASDPVL 1239
            |:.||......|            |::..|.::..||     .||..|||...||.|.|
Mouse   732 TMEERFRPLTFH------------GLVLRSQLVTLLV-----RGVCYSESQSSASQPRL 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 28/128 (22%)
CBS 952..1067 CDD:223591 24/114 (21%)
CBS 1023..1141 CDD:223591 24/132 (18%)
CBS_pair_28 1097..1215 CDD:240012 19/126 (15%)
CBS 1097..1213 CDD:223591 19/124 (15%)
Clcn6NP_036059.1 ClC_6_like 49..589 CDD:239657 11/33 (33%)
Voltage_CLC 140..571 CDD:279048 4/14 (29%)
Selectivity filter part_1. /evidence=ECO:0000250 156..160
Selectivity filter part_2. /evidence=ECO:0000250 198..202
Selectivity filter part_3. /evidence=ECO:0000250 488..492
CBS 609..656 CDD:214522 15/83 (18%)
CBS_pair_EriC_assoc_euk_bac <801..854 CDD:239964
CBS 804..>854 CDD:223591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.