DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and AgaP_AGAP005777

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:XP_001688728.1 Gene:AgaP_AGAP005777 / 1276446 VectorBaseID:AGAP005777 Length:917 Species:Anopheles gambiae


Alignment Length:213 Identity:45/213 - (21%)
Similarity:76/213 - (35%) Gaps:53/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 STERMAMAGVGSRSGSLERRRSGEDSPVLNQSTVHGIASPNRRPTIFDVFRPRAKSDAKRQKEKH 702
            |.:..:...|||:.|. ....||.:..:...:|.....:|.   |:..|  |..::|     |..
Mosquito    30 SGDHPSYQSVGSKPGK-GSPASGAERHITTTTTTSLTTAPG---TVGAV--PVYEAD-----EDG 83

  Fly   703 LLDPSSADSSATS-----STYSVSG----GTGPATSSAAGGAGGAAAAAGQGAAGGA-------- 750
            ::|.:..:...|:     |:||.:|    |.|..:|:|...|......||..:.|||        
Mosquito    84 MIDITPGNGGLTNPNYSYSSYSANGGRQDGVGAPSSAANSSAPNITTTAGASSNGGASIGGGEGP 148

  Fly   751 GGLMNSMKVAM-QNFSHRQHPAVTITSADGTQSTAK--SKYKDGSAHPHQGSDAQYYHTVTAVRP 812
            ||:.:...... ::|.|..|..::......|.....  .:|:|             :||:...|.
Mosquito   149 GGMSSPTHTRFGRDFHHSDHEGISFAGMTDTSDDIPGIGQYED-------------FHTIDWQRD 200

  Fly   813 NSSQRSPMTKVMDLFRHR 830
            .:..|         .|||
Mosquito   201 IARDR---------MRHR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990
CBS 952..1067 CDD:223591
CBS 1023..1141 CDD:223591
CBS_pair_28 1097..1215 CDD:240012
CBS 1097..1213 CDD:223591
AgaP_AGAP005777XP_001688728.1 ClC_3_like 240..743 CDD:239656
Voltage_CLC 323..723 CDD:279048
CBS 762..900 CDD:223591
CBS_pair_EriC_assoc_euk_bac 765..902 CDD:239964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.