DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNF4Agamma and AgaP_AGAP011133

DIOPT Version :9

Sequence 1:NP_001163671.1 Gene:SNF4Agamma / 42515 FlyBaseID:FBgn0264357 Length:1400 Species:Drosophila melanogaster
Sequence 2:XP_309514.2 Gene:AgaP_AGAP011133 / 1270793 VectorBaseID:AGAP011133 Length:538 Species:Anopheles gambiae


Alignment Length:199 Identity:42/199 - (21%)
Similarity:79/199 - (39%) Gaps:43/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   962 NGVRAAPLWDSEK--QQFVGMLTITDFIKILQMYYKSPNASMEQLEEHKLDTWRSVLHNQVMPLV 1024
            ||....|:.::.|  .:.||::|..|.                ...||.:|.....:..::..|:
Mosquito   158 NGFTGYPITENGKIGTRLVGIVTSRDI----------------DFREHDVDIKLKDIMTKLEDLI 206

  Fly  1025 SIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPK----PAYMQK 1085
            :.....:|.:|..|:..|:..:||::: .||.::.::..           .:|.|    |..::.
Mosquito   207 TAPNGVTLQEANNIMEKSKKGKLPIVN-KTGELVALIAR-----------TDLKKGRTYPNALKD 259

  Fly  1086 SLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYN 1150
            |.::|.:|.  .|.|.||...   .|:...:..|..:.|..|.|.  .:| :.::|....|| |.
Mosquito   260 SNKQLLVGA--AIGTRDEDKE---RLELLYQNGVDVIVLDSSQGN--SLY-QINMIKYIKEK-YP 315

  Fly  1151 DLDV 1154
            .|.|
Mosquito   316 SLQV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNF4AgammaNP_001163671.1 CBS_pair_5 941..1069 CDD:239990 20/108 (19%)
CBS 952..1067 CDD:223591 20/106 (19%)
CBS 1023..1141 CDD:223591 25/121 (21%)
CBS_pair_28 1097..1215 CDD:240012 16/58 (28%)
CBS 1097..1213 CDD:223591 16/58 (28%)
AgaP_AGAP011133XP_309514.2 PTZ00314 37..534 CDD:240355 42/199 (21%)
IMPDH 50..517 CDD:238223 42/199 (21%)
CBS_pair_IMPDH_2 136..249 CDD:239975 21/118 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.