DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and Tollo

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:414 Identity:90/414 - (21%)
Similarity:158/414 - (38%) Gaps:99/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NLKYPSASAVA--YFSENVTKHLRK-----YETLVLHSSDLANLPRKIFLNLPQLVEFHVLECEL 99
            |..|.....::  |||.:::....:     .::|.|.::.:.:||..:...|.:|...::.:..:
  Fly   182 NASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSM 246

  Fly   100 QQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRP------- 157
            ..:....|:|..:|:.::...|.|..|....|....||:|:.|.:|.:..|...||..       
  Fly   247 SFLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVL 311

  Fly   158 -------------------LKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELF 203
                               ||.|..::||.|::..|..|||..|.||:.:.::.|.:.:|||.:|
  Fly   312 DLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIF 376

  Fly   204 RD---------QRKHLSEFSAQSNQ------LVRIPFNIFREIDHLSLSFNPQLRRLHLSAKINE 253
            .|         .|..:|....::.|      ::.:.||....:|..||....||:.|||:.  |:
  Fly   377 ADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLND--NK 439

  Fly   254 LEATNCDLESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYRLDFLSKASKLVDLD 318
            |:|.                               |:.|.|:.|..|                ||
  Fly   440 LQAV-------------------------------PEALAHVQLLKT----------------LD 457

  Fly   319 V-TDIVNLADLPKITSAKGLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDED 382
            | .::::..:...||..:.|..|..|.::||.....:...:..|..|.:|..|.|.|....|..:
  Fly   458 VGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRN 522

  Fly   383 FFVEEAELNCGQLADLLE-FVELP 405
            ..::...|:..||..:.. |.|||
  Fly   523 SQLQAIRLDGNQLKSIAGLFTELP 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 13/59 (22%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR_8 135..195 CDD:290566 22/85 (26%)
LRR_4 135..175 CDD:289563 14/65 (22%)
leucine-rich repeat 137..160 CDD:275380 8/48 (17%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 8/32 (25%)
leucine-rich repeat 210..231 CDD:275380 4/26 (15%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 18/98 (18%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566 7/39 (18%)
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380 5/18 (28%)
LRR 210..656 CDD:227223 85/386 (22%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 236..259 CDD:275380 3/22 (14%)
leucine-rich repeat 260..283 CDD:275380 5/22 (23%)
LRR_RI 276..558 CDD:238064 73/320 (23%)
leucine-rich repeat 284..307 CDD:275380 7/22 (32%)
leucine-rich repeat 308..333 CDD:275380 1/24 (4%)
leucine-rich repeat 334..357 CDD:275380 9/22 (41%)
leucine-rich repeat 358..381 CDD:275380 7/22 (32%)
leucine-rich repeat 382..405 CDD:275380 3/22 (14%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 10/54 (19%)
leucine-rich repeat 453..500 CDD:275380 11/62 (18%)
leucine-rich repeat 501..521 CDD:275380 7/19 (37%)
leucine-rich repeat 525..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.