DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and Tl

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster


Alignment Length:438 Identity:97/438 - (22%)
Similarity:174/438 - (39%) Gaps:88/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SASAVAYFSENVTKHLRKYETLVLH--------SSDLANLPRKIFLNLPQLVEFHVLECELQQIE 103
            |.:.:.:.|:|:..::.:.....||        :..|.::|..:..::..|.... |...::::.
  Fly   126 SPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLE-LRANIEEMP 189

  Fly   104 SVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSN 168
            |..||..:||:.:.||.|.||.:....|....:|::|||..|||.:|....|....::..|::.:
  Fly   190 SHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHD 254

  Fly   169 NRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQ--LVRIPFNIFREI 231
            |.:..|...:|:.|.::..||:.:|....||..|| |..|||:|....:|:  |..:|..:|.. 
  Fly   255 NGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLF-DHNKHLNEVRLMNNRVPLATLPSRLFAN- 317

  Fly   232 DHLSLSFNPQLRRLHLSAKINELEAT----NCDLESVELDGRVI----GVQLEANPKLHELKISQ 288
                   .|:|:.|.|.|::..|...    :..:.::.|...::    ...||....|..|.:|.
  Fly   318 -------QPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSN 375

  Fly   289 PQDLEH----LYLANTNLYRL------------DFLSKASKLVDLDVT-DIVNLADLPKITSAKG 336
            .: |.|    |:...|||..|            |..|....||.|.:: :.:...|.....|..|
  Fly   376 NR-LTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNG 439

  Fly   337 LERLSFTYDNLTSNHMDMLPHLKDL--------------NYLEISHEKGKEIFI----------- 376
            |..|     :|..|.:|:...|.|:              ..|.::......||:           
  Fly   440 LRHL-----HLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQL 499

  Fly   377 KDLD-----------EDF-FVEEAELNCGQLADLLEFVELPKDTTILE 412
            ::||           ||. |:.:..|:.....:.:..:.||:|..:.|
  Fly   500 RELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 4/30 (13%)
LRR_8 87..147 CDD:290566 18/59 (31%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 17/59 (29%)
LRR_4 135..175 CDD:289563 11/39 (28%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..209 CDD:275380 8/23 (35%)
leucine-rich repeat 210..231 CDD:275380 6/22 (27%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566 18/59 (31%)
leucine-rich repeat 176..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..222 CDD:275380 7/22 (32%)
LRR_RI 216..542 CDD:238064 76/340 (22%)
LRR_8 221..281 CDD:290566 17/59 (29%)
leucine-rich repeat 223..270 CDD:275380 14/46 (30%)
leucine-rich repeat 271..294 CDD:275380 8/23 (35%)
leucine-rich repeat 295..320 CDD:275380 6/32 (19%)
leucine-rich repeat 321..343 CDD:275380 5/21 (24%)
LRR_8 342..402 CDD:290566 13/60 (22%)
leucine-rich repeat 344..367 CDD:275380 3/22 (14%)
leucine-rich repeat 368..391 CDD:275380 6/23 (26%)
LRR_8 390..450 CDD:290566 16/64 (25%)
leucine-rich repeat 392..415 CDD:275380 4/22 (18%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
leucine-rich repeat 440..474 CDD:275380 7/38 (18%)
leucine-rich repeat 475..498 CDD:275380 3/22 (14%)
LRR_8 477..534 CDD:290566 8/56 (14%)
leucine-rich repeat 499..520 CDD:275380 4/20 (20%)
leucine-rich repeat 523..552 CDD:275380 5/25 (20%)
LRRCT 561..619 CDD:214507
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.