Sequence 1: | NP_650952.2 | Gene: | CG5810 / 42513 | FlyBaseID: | FBgn0038866 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262529.1 | Gene: | 2mit / 41616 | FlyBaseID: | FBgn0260793 | Length: | 1155 | Species: | Drosophila melanogaster |
Alignment Length: | 392 | Identity: | 90/392 - (22%) |
---|---|---|---|
Similarity: | 159/392 - (40%) | Gaps: | 120/392 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 EFHV---LECELQQIESVCFDGAKNLKRLNFGGNALRVL-----DSNTFELATQLEELNLSDNQL 147
Fly 148 EDLPTTIF-RPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLS 211
Fly 212 EFSAQSNQL----VR----IPFNIFREIDHLSLSFNP---------------------------- 240
Fly 241 ------QLRRLHLSAKINELEATNC-DLESVEL-------DGRVIGVQLEANPKLHELK------ 285
Fly 286 -------ISQPQDLEHLYLANTNLYRLD---FLSKASKLVDLDVTDIVN--LADLPKITSAK--- 335
Fly 336 -GLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDEDFFVEEAELNCGQLADLL 399
Fly 400 EF 401 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5810 | NP_650952.2 | leucine-rich repeat | 65..88 | CDD:275380 | |
LRR_8 | 87..147 | CDD:290566 | 18/63 (29%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 8/27 (30%) | ||
LRR_8 | 135..195 | CDD:290566 | 17/60 (28%) | ||
LRR_4 | 135..175 | CDD:289563 | 12/40 (30%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 185..209 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 210..231 | CDD:275380 | 6/28 (21%) | ||
2mit | NP_001262529.1 | LRR_RI | 124..355 | CDD:238064 | 56/241 (23%) |
leucine-rich repeat | 124..143 | CDD:275380 | 4/18 (22%) | ||
leucine-rich repeat | 144..167 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 172..194 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 193..253 | CDD:290566 | 14/60 (23%) | ||
leucine-rich repeat | 195..218 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 219..242 | CDD:275380 | 4/23 (17%) | ||
LRR_8 | 241..301 | CDD:290566 | 10/64 (16%) | ||
leucine-rich repeat | 243..311 | CDD:275380 | 10/72 (14%) | ||
leucine-rich repeat | 312..335 | CDD:275380 | 11/24 (46%) | ||
LRR_8 | 334..415 | CDD:290566 | 20/84 (24%) | ||
leucine-rich repeat | 336..359 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 360..380 | CDD:275380 | 3/19 (16%) | ||
LRR_8 | 379..460 | CDD:290566 | 25/108 (23%) | ||
LRR_4 | 379..>415 | CDD:289563 | 12/39 (31%) | ||
leucine-rich repeat | 381..404 | CDD:275380 | 8/26 (31%) | ||
leucine-rich repeat | 405..449 | CDD:275380 | 11/45 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453504 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45617 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |