DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG18249

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:422 Identity:94/422 - (22%)
Similarity:159/422 - (37%) Gaps:103/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNYLNYILIAVI-------------------------AFATCESQKLEEIAIDSLDCRENTCTNL 43
            :::..|||:.:.                         :|.:...:.:...|..:|..||....|.
  Fly     1 MHFYKYILLGICGLTVSDALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLRELHLRNC 65

  Fly    44 KYPSAS------------------AVAYFSENVTKHLRKYETLVLHSSDLANLPRKIFLNLPQLV 90
            ...|.:                  |..:.|:...:.:....:|.:..:.|..|..:||..:|:|.
  Fly    66 SRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLE 130

  Fly    91 EFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIF 155
            ...:.:..:..:....|.|...|:.|...|||:..:.|:|.:...:|..|:||.|:|..||..||
  Fly   131 ILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIF 195

  Fly   156 RPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQL 220
            ...|.||.:.|:.|.|..|...:   ||||.::     :|::|         .|.:|....:..|
  Fly   196 AKNKKLQTLLLNGNPLRILMPDV---LGSLPNL-----RLLDL---------GHAAELEVMTLNL 243

  Fly   221 VRIPFNIFREIDHLSLSFNPQLRRLHLSAKINELEATNCDLESVELDGR--VIGVQLEANPKLHE 283
            ..:. |:..|...||        .|.::....:|:|.|.:|..:::..:  ||.:.|..|     
  Fly   244 TNVQ-NLVLEGSSLS--------SLVINGGFIKLQAGNNELNHLQVGNKSSVIEMDLHGN----- 294

  Fly   284 LKISQPQDLEHLYLANTNLYRLDFLSKASKLVDLDVTDIVNLADLPKITS---AKGLERL----S 341
              :....|...|.....||.||| |||.            .:..||:..|   |.|.:.|    |
  Fly   295 --LLNGNDTAALLRGMWNLQRLD-LSKN------------RIEALPQHGSGLDASGTQELLILPS 344

  Fly   342 FTYDNLTSNHMDMLPH-----LKDLNYLEISH 368
            ..:.||.:|.:..||.     ...|:||::||
  Fly   345 LKFLNLANNQLVRLPPESPILSSRLSYLDLSH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 16/59 (27%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 21/59 (36%)
LRR_4 135..175 CDD:289563 16/39 (41%)
leucine-rich repeat 137..160 CDD:275380 10/22 (45%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..209 CDD:275380 3/23 (13%)
leucine-rich repeat 210..231 CDD:275380 3/20 (15%)
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 4/22 (18%)
LRR_8 104..163 CDD:290566 13/58 (22%)
leucine-rich repeat 105..128 CDD:275380 5/22 (23%)
LRR_RI 107..438 CDD:238064 82/316 (26%)
leucine-rich repeat 129..152 CDD:275380 3/22 (14%)
leucine-rich repeat 153..176 CDD:275380 7/22 (32%)
LRR_8 176..232 CDD:290566 23/72 (32%)
leucine-rich repeat 177..200 CDD:275380 10/22 (45%)
leucine-rich repeat 201..224 CDD:275380 10/25 (40%)
leucine-rich repeat 225..258 CDD:275380 9/55 (16%)
leucine-rich repeat 259..310 CDD:275380 11/57 (19%)
leucine-rich repeat 311..344 CDD:275380 13/45 (29%)
LRR_8 343..403 CDD:290566 11/34 (32%)
leucine-rich repeat 345..368 CDD:275380 5/22 (23%)
leucine-rich repeat 369..390 CDD:275380 5/8 (63%)
leucine-rich repeat 393..417 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.