DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and atk

DIOPT Version :10

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster


Alignment Length:458 Identity:116/458 - (25%)
Similarity:188/458 - (41%) Gaps:91/458 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLNYILIAVIAFATCESQKLEEIAIDSLDCRENTCTNLKYPSASAVAYFSENVTKHLRKYETLV- 69
            :||.:...::.....|.| |..|..:||    |...|:     .|:...||.: |||..:..|: 
  Fly   107 WLNELENGLVEIFVVEPQ-LRSIPAESL----NGMINM-----LAITIQSEEL-KHLPDFSGLLS 160

  Fly    70 -----LHSSDLANLPRKIFLNLPQLVEFHVL-ECELQQIESVCFDGAKNLKRLNFGGNALRVLDS 128
                 :.:..|..||..:|.:||:|...|:. ...|.::|:..|||..:||.|:...|.|..:..
  Fly   161 LTYLSVQTGALQELPSHLFRHLPKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNWIHL 225

  Fly   129 NTFELATQLEELNLSDNQLEDLPTT--IFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVD 191
            ........|..|.||.||:.|:...  |.:.|::|:|:.|.||.:..:....|..|.:|..::::
  Fly   226 RALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLN 290

  Fly   192 SNQLVELP-GELFRDQRKHLSEFSAQSNQLVRI-PFNIFR--------------EIDHLS----- 235
            .|::.||. |...|..:  |.....|:|.:.|| |.::.:              ||.|:.     
  Fly   291 DNRITELQYGAFLRTPQ--LKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRAL 353

  Fly   236 LSFNPQLRRLHLSAK---------------INELEATNCDLESVELDGRVIGVQLEANPKLHELK 285
            |...|:||.|.:|..               :.:|...:..|..:|.|.      |.|.|.|.||:
  Fly   354 LDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDA------LMAMPALRELR 412

  Fly   286 I---SQPQD----------LEHLYLANTNLYRLD--FLSKASKLVDLDVTD--IVNLADLPKITS 333
            :   |...|          |:.|.||.....|:|  .|:....|..||:::  ::.||.    .|
  Fly   413 MRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAP----NS 473

  Fly   334 AKG---LERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDEDFFVEEAELNCGQL 395
            .:.   ||.|:.:.:.||..|...|.||:.|..::.|:.:.|.: |..|..  .||...|...|:
  Fly   474 FRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSV-IAGLPR--IVERISLKGNQI 535

  Fly   396 ADL 398
            ..|
  Fly   536 TSL 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 LRR <61..353 CDD:443914 89/356 (25%)
leucine-rich repeat 65..88 CDD:275380 6/28 (21%)
leucine-rich repeat 89..112 CDD:275380 7/23 (30%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
leucine-rich repeat 137..160 CDD:275380 9/24 (38%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..209 CDD:275380 6/24 (25%)
leucine-rich repeat 210..231 CDD:275380 6/35 (17%)
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380 2/5 (40%)
LRR 93..530 CDD:443914 113/448 (25%)
leucine-rich repeat 115..138 CDD:275380 7/27 (26%)
leucine-rich repeat 139..160 CDD:275380 7/26 (27%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..209 CDD:275380 7/23 (30%)
leucine-rich repeat 210..233 CDD:275380 5/22 (23%)
leucine-rich repeat 234..259 CDD:275380 9/24 (38%)
leucine-rich repeat 260..283 CDD:275380 7/22 (32%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..359 CDD:275380 10/50 (20%)
leucine-rich repeat 334..348 CDD:275378 3/13 (23%)
PLN00113 359..>824 CDD:215061 48/193 (25%)
leucine-rich repeat 360..383 CDD:275380 4/22 (18%)
leucine-rich repeat 384..407 CDD:275380 6/28 (21%)
leucine-rich repeat 408..431 CDD:275380 5/22 (23%)
leucine-rich repeat 432..455 CDD:275380 7/22 (32%)
leucine-rich repeat 456..476 CDD:275380 6/23 (26%)
leucine-rich repeat 480..501 CDD:275380 7/20 (35%)
leucine-rich repeat 505..517 CDD:275378 2/11 (18%)
leucine-rich repeat 525..550 CDD:275380 5/14 (36%)
leucine-rich repeat 551..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..670 CDD:275380
leucine-rich repeat 671..693 CDD:275380
leucine-rich repeat 694..717 CDD:275380
leucine-rich repeat 718..741 CDD:275380
leucine-rich repeat 742..763 CDD:275380
leucine-rich repeat 766..789 CDD:275380
leucine-rich repeat 790..813 CDD:275380
leucine-rich repeat 814..835 CDD:275380
leucine-rich repeat 838..861 CDD:275380
leucine-rich repeat 862..885 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.