DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and Toll-9

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster


Alignment Length:450 Identity:104/450 - (23%)
Similarity:167/450 - (37%) Gaps:131/450 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESQKLEEIAIDSLDCRENTCTNLKYPSASAVAYF--------SENVTKHLRKYETLVLHSSDLAN 77
            ||.||       |..|.|....| .|.|...|.|        |.:|..|.   |.|:||::    
  Fly   155 ESLKL-------LSLRGNNFAEL-IPDAEDFARFVNESRLEASNSVPHHC---ELLLLHNT---- 204

  Fly    78 LPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGG----NALRVLDSN--------- 129
                        .:.:..||.|.      |:...|:.:....|    |.::||...         
  Fly   205 ------------TDLYDRECYLY------FNNNTNMGQSITTGRNYTNFIKVLKDRFDQHGSSSQ 251

  Fly   130 -----TFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSIN 189
                 ||....:|.||::|:..:|.:....||.:.||:::.:|:|:::|:|...|..:..::.::
  Fly   252 SIAWATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQGVQYLD 316

  Fly   190 VD-------SNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHL 247
            :.       |.|| :||  ........:.....|.|....:|..|:.::.|..::.|..:...||
  Fly   317 LSFTNFLTYSYQL-QLP--TLEMALSLIYGLKIQQNVFKYLPELIYLDLSHSKMTRNSAVAFAHL 378

  Fly   248 SAKINELEA-------------TNCDLESVELDGRVIGVQLEANPKLHELKISQPQD-----LEH 294
            ..|:..|..             .|..||.::|.|         ||.|....|....|     |::
  Fly   379 GDKLKFLSLCYTAIPMVSSTIFKNTVLEGLDLSG---------NPYLSYNIIDDAFDGIANTLKY 434

  Fly   295 LYLANTNLYRLDFLSKASKLVDLDVTDI----VNLADLPKITSAKGLERLSFTYD---------- 345
            ||...:|:..|:: ||:.|  :|.|..:    :|........|.:.||.|..:.:          
  Fly   435 LYFERSNIKDLEW-SKSLK--NLQVLGLAGNNINALTPAMFQSLESLEILDLSSNHVGNWYRSAF 496

  Fly   346 ---------NLTSNHMDMLPH--LKD---LNYLEISHEKGKEIFIKDLDEDFFVEEAELN 391
                     ||.||.::||.:  |||   |:||.:    |...||.|......||.|..|
  Fly   497 HNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSL----GDNDFICDCHLRAVVEVAAAN 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 4/22 (18%)
LRR_8 87..147 CDD:290566 15/77 (19%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 6/40 (15%)
LRR_8 135..195 CDD:290566 15/66 (23%)
LRR_4 135..175 CDD:289563 12/39 (31%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 5/30 (17%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380 10/35 (29%)
LRR_8 262..322 CDD:290566 14/59 (24%)
leucine-rich repeat 264..287 CDD:275380 7/22 (32%)
leucine-rich repeat 288..311 CDD:275380 6/22 (27%)
leucine-rich repeat 312..356 CDD:275380 7/46 (15%)
LRR_8 <344..387 CDD:290566 10/42 (24%)
leucine-rich repeat 357..381 CDD:275380 5/23 (22%)
leucine-rich repeat 382..397 CDD:275380 1/14 (7%)
leucine-rich repeat 405..430 CDD:275380 9/33 (27%)
LRR_8 431..488 CDD:290566 15/59 (25%)
leucine-rich repeat 432..453 CDD:275380 8/23 (35%)
LRR_RI <449..536 CDD:238064 22/92 (24%)
leucine-rich repeat 454..477 CDD:275380 4/22 (18%)
LRR_8 477..536 CDD:290566 16/62 (26%)
leucine-rich repeat 478..501 CDD:275380 3/22 (14%)
leucine-rich repeat 502..525 CDD:275380 9/22 (41%)
TIR 751..891 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.