DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and trn

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:424 Identity:100/424 - (23%)
Similarity:170/424 - (40%) Gaps:91/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SAVAYFSENVTKHLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNL 113
            |::.:::|        ...|.|.|:.|..:|::.|....:|.|.|:...::.||.:..|.|...:
  Fly    76 SSIQFYAE--------LTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAV 132

  Fly   114 KRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQH- 177
            ..||..||.:..|...||....::|||||.:|::..|....|..|..|:.:.|.:|.|.|:... 
  Fly   133 TVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPV 197

  Fly   178 IFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQL 242
            ||..:.||..:.:..|.|..:..:.|:| .|.|:....:...|        |.|.|.|.....:|
  Fly   198 IFQAMPSLAELFLGMNTLQSIQADAFQD-LKGLTRLELKGASL--------RNISHDSFLGLQEL 253

  Fly   243 RRLHLS---------------AKINELEATNCDLESVELDGRVIGV----QLEANPKLHELKISQ 288
            |.|.||               .::.:|.....|.|.:. :|..:|:    :||.|..|...::  
  Fly   254 RILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVIS-EGAFMGLKQLKRLEVNGALRLKRV-- 315

  Fly   289 PQDLEHLYLANTNLYRLDFLSKASKLVDLDVTDIVNLADLPKITSAKGLERLSFTY---DNLTSN 350
               :...:..|.|   |::|:.:|..:.|:|.:          .:..||.:|....   :.|||.
  Fly   316 ---MTGAFSDNGN---LEYLNLSSNKMLLEVQE----------GALSGLSQLKHVVLKANALTSL 364

  Fly   351 HMDMLPHLKDLNYLEISHEK----------GKEIFIKDLDEDFFVEEAELNCGQLADLLEFVELP 405
            ...:.| .|||..|::|...          ...:..|:..:|   :.:||.|       ||.|..
  Fly   365 AEGLFP-WKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQD---DVSELLC-------EFPERL 418

  Fly   406 KDTTI--LEDRLVG----DPR-----GPMRCGMA 428
            :..::  |...::|    |||     |.:..|.|
  Fly   419 RGESLRHLNPAMMGCTHADPRKQALIGALLVGSA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 6/22 (27%)
LRR_8 87..147 CDD:290566 20/59 (34%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 19/60 (32%)
LRR_4 135..175 CDD:289563 14/39 (36%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 7/23 (30%)
leucine-rich repeat 185..209 CDD:275380 5/23 (22%)
leucine-rich repeat 210..231 CDD:275380 3/20 (15%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 1/3 (33%)
LRR_8 83..142 CDD:290566 18/66 (27%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 77/330 (23%)
LRR_8 132..190 CDD:290566 19/57 (33%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
LRR_8 203..263 CDD:290566 18/68 (26%)
leucine-rich repeat 205..228 CDD:275380 5/23 (22%)
leucine-rich repeat 229..252 CDD:275380 6/30 (20%)
LRR_8 252..308 CDD:290566 12/56 (21%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 5/23 (22%)
leucine-rich repeat 301..322 CDD:275380 4/25 (16%)
LRR_8 325..384 CDD:290566 18/72 (25%)
leucine-rich repeat 326..350 CDD:275380 7/33 (21%)
leucine-rich repeat 351..373 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.