DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG42709

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:125/354 - (35%) Gaps:91/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NYILIAVIAFATCESQKLEEIAIDSLDCRENTCTNLKYPSASAVAYFSENVTKHLRKYETLVLHS 72
            |.:.:....|..|.:..|..:.:|             .|..:|:...|.||...||        .
  Fly    96 NCLCLEDFKFVQCANAHLTHVPLD-------------MPKTAAIIDLSHNVIAELR--------P 139

  Fly    73 SDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQL 137
            .|.|||.|.:.:||.     |.|   :..|:...|.|::.||||....|.|..:|.:||..|.:|
  Fly   140 EDFANLSRAVEINLN-----HNL---ISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKEL 196

  Fly   138 EELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGEL 202
            ..|:||:|.:.......|....:|.:.:..|.....|.:..|..:..|:.:.::.|         
  Fly   197 TLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKN--------- 252

  Fly   203 FRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLH------LSAKINELEATNCDL 261
                     :|..|.|...   |:...:|..|.|   |:|.:.:      |...|:.:...|.|:
  Fly   253 ---------DFKQQINTKA---FSPLTKIIKLKL---PELEQQNIEELCSLLTSIDTISFLNYDI 302

  Fly   262 ESVELDGRVIGVQLEAN---PKLHELK-ISQPQDLEHL--------------YLANTNLYRLDFL 308
            ...|.   |:|.....:   |....|| |:.|..:..:              ..||.|..::|  
  Fly   303 SCYEF---VLGTPFNGSLIYPTEPPLKGITNPPIVASITSTAKPVTATPAPPRSANRNRGKMD-- 362

  Fly   309 SKASKLVDLDVTDIVNLADLPKITSAKGL 337
                     :.|::|....|...||..|:
  Fly   363 ---------NSTELVKAGILSSETSTSGV 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 7/22 (32%)
LRR_8 87..147 CDD:290566 20/59 (34%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 10/22 (45%)
LRR_8 135..195 CDD:290566 12/59 (20%)
LRR_4 135..175 CDD:289563 8/39 (21%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 4/22 (18%)
leucine-rich repeat 185..209 CDD:275380 2/23 (9%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 22/71 (31%)
leucine-rich repeat 128..147 CDD:275380 9/26 (35%)
leucine-rich repeat 148..171 CDD:275380 7/30 (23%)
LRR_RI <150..225 CDD:238064 24/82 (29%)
LRR_8 171..254 CDD:290566 22/100 (22%)
leucine-rich repeat 172..195 CDD:275380 10/22 (45%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.