DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG32055

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:506 Identity:119/506 - (23%)
Similarity:204/506 - (40%) Gaps:112/506 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRMLNYLNYILIAVIAFATCESQKLEEIAIDSLDCRE---------------------NTCTNL- 43
            |:.|..|..:|::.: |.. :.|:.|::...|..|||                     |..|.: 
  Fly     1 MQALQVLALLLLSGV-FGK-DLQECEDLGNGSYLCREIESFEQLNRYVGKNWKSVKVVNEHTGIE 63

  Fly    44 -----KYPSASAVAYF----SENVT---KHLRKYETLV---LHSSDLANLPRKIFLNLPQLVEFH 93
                 :.|..|.:...    |..||   |.|:.::.|.   |..:.|..|..:.|.|..:::.|.
  Fly    64 RAEDGELPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQFPNPSEMINFD 128

  Fly    94 VLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTF---------ELATQLEE---------- 139
            |...::..|.:....|..||...||..|.:.|::.|.|         :|.|..:|          
  Fly   129 VSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTNYQENITLGENANL 193

  Fly   140 --LNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVEL---- 198
              |::|:|.|.|......|.|..|::::|.:|.|..|...||..|.:|:.:||.:|.|.|:    
  Fly   194 RFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTL 258

  Fly   199 ---PGELFRDQRKHLSEFSAQSNQLVRIPFNIF---REIDHLSLSFNPQLRRLHLSAKINELEAT 257
               |||:   ....|.::|  ||.:..:..::|   :::..|:|..| |:.|:|..|.:.     
  Fly   259 FMAPGEI---APLELLDYS--SNIVKVLDDSVFCRLKKLRTLNLWLN-QINRIHPRAFLG----- 312

  Fly   258 NCDLESVELDGRVIGVQLEANPKLHELKISQPQD-------LEHLYLANTNLYRLDFLSKAS--- 312
            ...|:::.|.|..|.:              .|.|       ||.|.|:..|:.:|.......   
  Fly   313 LSSLQTLHLQGNKISI--------------LPDDVFANLTALEKLDLSKNNIQKLGLRVFGERIL 363

  Fly   313 -KLVDLDVTDIVNLADLP--KITSAKGLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEI 374
             ||:.||:::.. :|||.  .::|...::.|....:.|.|..:.|...|:.|..|.|:..:.:||
  Fly   364 RKLIYLDLSNNY-IADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEI 427

  Fly   375 FIKDLDEDFFVEEAELNCGQLADLLEFVELPKDTTILEDRLVGDPRGPMRC 425
            ..:.||....:...|||..:|..|   .:|.....:|:.|.:.....|.:|
  Fly   428 DGEILDTLDRLNHLELNNNRLTFL---PDLKSSQNLLQLRNITLEGNPWQC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 6/25 (24%)
LRR_8 87..147 CDD:290566 18/80 (23%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 8/31 (26%)
LRR_8 135..195 CDD:290566 21/71 (30%)
LRR_4 135..175 CDD:289563 13/51 (25%)
leucine-rich repeat 137..160 CDD:275380 8/34 (24%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..209 CDD:275380 9/30 (30%)
leucine-rich repeat 210..231 CDD:275380 5/23 (22%)
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 128..180 CDD:290566 12/51 (24%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..192 CDD:275380 3/19 (16%)
LRR_RI <187..400 CDD:238064 57/238 (24%)
LRR_8 192..251 CDD:290566 19/58 (33%)
leucine-rich repeat 193..216 CDD:275380 7/22 (32%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..267 CDD:275380 9/28 (32%)
leucine-rich repeat 268..291 CDD:275380 5/24 (21%)
LRR_8 290..350 CDD:290566 17/79 (22%)
leucine-rich repeat 292..315 CDD:275380 7/28 (25%)
leucine-rich repeat 316..339 CDD:275380 6/36 (17%)
LRR_8 340..400 CDD:290566 15/60 (25%)
leucine-rich repeat 340..365 CDD:275380 6/24 (25%)
leucine-rich repeat 366..389 CDD:275380 7/23 (30%)
leucine-rich repeat 390..413 CDD:275380 5/22 (23%)
LRR_8 391..448 CDD:290566 15/56 (27%)
leucine-rich repeat 414..437 CDD:275380 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.