DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and ltl

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster


Alignment Length:477 Identity:106/477 - (22%)
Similarity:192/477 - (40%) Gaps:115/477 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IAFATCES-----------QKLEEI--AIDSLDCRENTCTN--LKYPSA---------------- 48
            |:..|||:           :|||..  .:|||..:.|..||  ||...:                
  Fly    22 ISPCTCETGKAWNHVELSCEKLESFNAVVDSLANKLNADTNIDLKITHSQLDDLEMRSFTDMNFN 86

  Fly    49 --------SAVAYFSENVTKHLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESV 105
                    :::....|...:.|.....|.:..:||..:|:....::|.|:...:..|:::.::..
  Fly    87 LYKLRMQWNSLKSLPEVPFRGLSNVTYLSIGDNDLDEIPKHALSHMPSLLTLDIGRCKIRAVQQE 151

  Fly   106 CFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNR 170
            .|.|.:.:..|....|.:..||..:|..:..:  |:|..||||.|..:: ..|.||:.:.::.|.
  Fly   152 DFRGIQRVTNLILVSNIITRLDRGSFPKSLLI--LHLGRNQLESLNGSL-HDLHNLESLFINANN 213

  Fly   171 LITLSQHIFSQLGSLKSINVDSNQLVELPGELF-------------------RDQRK--HLSEFS 214
            :.:|...: ...|.|:.:...:|:|..||..:.                   |..|.  :|||..
  Fly   214 ITSLDDEL-PDGGQLRLLMAHNNRLERLPANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVM 277

  Fly   215 AQSNQLVRIPFNIF-------------REIDHLSLSFNPQLRRLHLSAKINELEATNCDLESVEL 266
            |.:|:|..:..:.|             ..|..|:.|..|.|:..:.:...|::|    :....||
  Fly   278 ADNNELEYLAQDEFASCSKVETLQMGCNHIKSLNSSLLPILKLKNANFSFNDIE----EFSMAEL 338

  Fly   267 DG--RVIGVQLEANPKLHELKISQPQDLEHLYLANTNL--YRLDFLSKASKLVDLDVTDIVNLA- 326
            .|  .:..:||.:| ::..| :..|:.::.|.|.|.:|  .|:|.|:.|  |..|....|:||| 
  Fly   339 HGLRSLKTLQLSSN-RIQRL-LPDPRGVQELMLVNLDLDNNRIDSLNGA--LAGLGNLRILNLAG 399

  Fly   327 ---DLPKITSAKGLERLSFTYDNLTSN--------HMDMLPHLKDLNYLEISHEKGKEIFIKDLD 380
               :..::....|:.||...  :||.|        .|.:||.||   .|::::..     |..|:
  Fly   400 NRLEHLQVGDFDGMIRLDIL--DLTGNQLAELKPLEMTLLPSLK---ILKVAYNN-----ITKLE 454

  Fly   381 EDF----FVEEAELNCGQLADL 398
            :||    .:.:|.|...|::.:
  Fly   455 QDFKGLPVLCQANLTNNQISTI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 4/22 (18%)
LRR_8 87..147 CDD:290566 13/59 (22%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR_8 135..195 CDD:290566 15/59 (25%)
LRR_4 135..175 CDD:289563 11/39 (28%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 3/22 (14%)
leucine-rich repeat 185..209 CDD:275380 7/44 (16%)
leucine-rich repeat 210..231 CDD:275380 7/33 (21%)
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380 2/20 (10%)
LRR_8 86..145 CDD:290566 9/58 (16%)
leucine-rich repeat 87..110 CDD:275380 2/22 (9%)
leucine-rich repeat 111..134 CDD:275380 4/22 (18%)
leucine-rich repeat 135..158 CDD:275380 4/22 (18%)
LRR_8 158..214 CDD:290566 16/58 (28%)
leucine-rich repeat 159..180 CDD:275380 5/20 (25%)
leucine-rich repeat 181..203 CDD:275380 8/24 (33%)
leucine-rich repeat 204..226 CDD:275380 3/22 (14%)
LRR_RI 226..451 CDD:238064 55/242 (23%)
leucine-rich repeat 227..249 CDD:275380 5/21 (24%)
leucine-rich repeat 250..272 CDD:275380 2/21 (10%)
leucine-rich repeat 273..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..315 CDD:275380 3/17 (18%)
LRR_8 319..402 CDD:290566 24/90 (27%)
leucine-rich repeat 320..335 CDD:275378 2/18 (11%)
leucine-rich repeat 344..366 CDD:275380 5/23 (22%)
leucine-rich repeat 367..391 CDD:275380 10/25 (40%)
LRR_8 369..426 CDD:290566 19/60 (32%)
leucine-rich repeat 392..415 CDD:275380 5/22 (23%)
leucine-rich repeat 416..439 CDD:275380 6/24 (25%)
LRR_8 438..>479 CDD:290566 11/47 (23%)
leucine-rich repeat 440..462 CDD:275380 7/29 (24%)
leucine-rich repeat 463..483 CDD:275380 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.