DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG18480

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:273 Identity:60/273 - (21%)
Similarity:102/273 - (37%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATCESQKLEEIAIDSLDCRENTCTNLKYPSASAVAYFSENVTKHLRKYETLVLHSSDLANLPRKI 82
            |.|.:::|....|:.....|  ..:|.|...:.:...|...|.||.   .|.|..:.:..|....
  Fly    58 AVCSAKRLISANIEIPTTVE--LLDLSYNDITTIDDDSFKTTIHLL---NLTLAHNAIHTLYGDA 117

  Fly    83 FLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQL 147
            |:.|.:|....:....|:||:....:....|..||..||.|..|.......:..|..|||.::|:
  Fly   118 FVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQV 182

  Fly   148 EDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSE 212
            ..|.|.:...|..|::::|:.|.|:|||...|....:|.|:||:.|                   
  Fly   183 NQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEEN------------------- 228

  Fly   213 FSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHLS-AKINELEATNCDLESVELDGRVIGVQLE 276
                       |||..|.:..::.....:...:.:| ....|::....|.|:|....:       
  Fly   229 -----------PFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNK------- 275

  Fly   277 ANPKLHELKISQP 289
             |.|...::..:|
  Fly   276 -NEKFESMEYLEP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 15/59 (25%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 21/59 (36%)
LRR_4 135..175 CDD:289563 13/39 (33%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..209 CDD:275380 5/23 (22%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 13/64 (20%)
LRR_RI <76..230 CDD:238064 44/188 (23%)
leucine-rich repeat 76..99 CDD:275380 5/24 (21%)
leucine-rich repeat 100..123 CDD:275380 6/25 (24%)
LRR_8 122..182 CDD:290566 15/59 (25%)
leucine-rich repeat 124..147 CDD:275380 4/22 (18%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_8 170..230 CDD:290566 21/89 (24%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.