DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG4168

DIOPT Version :10

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:432 Identity:108/432 - (25%)
Similarity:177/432 - (40%) Gaps:95/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNYLNYILIAVIAFATCES--------QKLEEIAIDSLDCRENTCTNLKY-PSASAVAYFSENVT 59
            |:|...:.|:..||....:        .:|..:::.|.....||.|.|:. .|.:.:|.|.:.::
  Fly   693 LSYNRLVNISHGAFTVLPNLAALDLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFYDELS 757

  Fly    60 KHLRKYETLVLHS--------SDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRL 116
            .::..|:..:.|:        ::|||..|  ||||        ...:|..::|..|...:.|:.|
  Fly   758 SYMYIYQLDISHNHVTKSDSFTNLANTLR--FLNL--------AHNQLGSLQSHAFGDLEFLEIL 812

  Fly   117 NFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIF-- 179
            |...|.|..|...:|:....|:||:||.|||:.|....|..|:.|:.:.:::|||..|.:.:|  
  Fly   813 NVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPREVFMN 877

  Fly   180 ----------SQLG------------SLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVR 222
                      :||.            :|:||.:..|.|..|...:|.:. :.|.:.|...|::..
  Fly   878 TRLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHNNLEYLDASMFINS-QFLYDISLARNRITI 941

  Fly   223 IPFNIFREIDHLSLSFNPQLRRLHLSAKINELEATNCDLESVELDGRVIGVQLEANPKLHELKIS 287
            :|.|.|        ||...|..|.||.  |.|..||                      |.|:.:.
  Fly   942 LPDNTF--------SFLNNLTNLDLSQ--NPLVTTN----------------------LREVFVH 974

  Fly   288 QPQDLEHLYLANTNLYRLDFLSKASKLVDLDVTDIVN--LADLPKITSAKGLERLSFTYDNLTSN 350
            .|: |..|.|.:..||.|..|    ||..|...|:..  |.:|..:.|.:.|..::.:::.|| |
  Fly   975 TPR-LRKLSLHHMGLYVLPPL----KLPLLSYLDVSGNYLQELSPLGSLRHLRHVNVSHNKLT-N 1033

  Fly   351 HMDMLPHL-KDLNYLEISHEKGKEIFIKDLDEDFFVEEAELN 391
            ......|| ..:..|:::|...:.|.:.||..  ....||||
  Fly  1034 ASCAAEHLPPSVRVLDLAHNPLRRITLHDLAS--LRHLAELN 1073

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 LRR <61..353 CDD:443914 83/325 (26%)
leucine-rich repeat 65..88 CDD:275380 10/30 (33%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
leucine-rich repeat 137..160 CDD:275380 11/22 (50%)
leucine-rich repeat 161..184 CDD:275380 8/46 (17%)
leucine-rich repeat 185..209 CDD:275380 7/23 (30%)
leucine-rich repeat 210..231 CDD:275380 6/20 (30%)
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR 543..971 CDD:443914 77/320 (24%)
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
leucine-rich repeat 688..711 CDD:275380 5/17 (29%)
leucine-rich repeat 712..735 CDD:275380 2/22 (9%)
leucine-rich repeat 740..783 CDD:275380 7/42 (17%)
leucine-rich repeat 785..808 CDD:275380 8/32 (25%)
leucine-rich repeat 809..832 CDD:275380 7/22 (32%)
leucine-rich repeat 833..856 CDD:275380 11/22 (50%)
leucine-rich repeat 857..879 CDD:275380 6/21 (29%)
leucine-rich repeat 880..900 CDD:275380 2/19 (11%)
leucine-rich repeat 905..928 CDD:275380 7/23 (30%)
LRR 911..>1203 CDD:443914 52/204 (25%)
leucine-rich repeat 929..952 CDD:275380 8/30 (27%)
leucine-rich repeat 953..977 CDD:275380 10/47 (21%)
leucine-rich repeat 978..1020 CDD:275380 14/45 (31%)
leucine-rich repeat 1045..1068 CDD:275380 5/24 (21%)
leucine-rich repeat 1069..1090 CDD:275380 4/5 (80%)
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.