DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and CG16974

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:429 Identity:103/429 - (24%)
Similarity:173/429 - (40%) Gaps:90/429 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNYLNYILIAVI------AFATCESQKLEEIAIDSLDCRENTCTNLKYPSASAVAY-----FSEN 57
            :|| |.:::|.:      .....:.:.|.|.:..|.:.::.|...|......:..|     .:||
  Fly   150 INY-NQLMLAHVPADRSNPLKLPQLESLREFSWQSSELKDETLMELFTRQPRSFEYMERLNLAEN 213

  Fly    58 --------VTKHLRKYETLVLHSSDLANLPRKIFLNL---PQLVEFHVLECELQQIESVCFDGAK 111
                    :...:|:.:.|.:..:.|:|..   .|||   .||.|.|:...||..:.........
  Fly   214 RLECLHWAIPLAVRRVKVLEMSGNRLSNCS---LLNLQYMKQLQELHLDRSELTYLPQRFLGELS 275

  Fly   112 NLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQ 176
            .|:.||...|.|..|..:.|..|.:||.|.||.|:|..||..:|:...:||.::||:|||::...
  Fly   276 ELRMLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPD 340

  Fly   177 HIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHL------- 234
            :.|::.|.|:.:::..|||..: |:......:.|.:.....|.|..|....|..:|||       
  Fly   341 NFFARNGQLRQLHLQRNQLKSI-GKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSG 404

  Fly   235 -------SLSFNP--QLRRLHLSAKINELEATNCDLESVELDGRVIGVQLEANP--------KLH 282
                   |:.|..  .||:|.||.  |:.:.....|  .:....::.::::..|        ..:
  Fly   405 NNLTLLSSIIFQSLHALRQLDLSR--NQFKQLPSGL--FQRQRSLVLLRIDETPIEQFSNWISRY 465

  Fly   283 ELKISQPQDLEHLYLANTNLYRLDFLS--KASKLVDLDVTDIVN-------------LADLP-KI 331
            :..:..||          .|:||.:||  :..||..|..|...|             |..|| :|
  Fly   466 DESLVDPQ----------VLHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQLPTQI 520

  Fly   332 TSAKGLERLSFTYDNLTSNHMDMLP----HLKDLNYLEI 366
            :....|:|||     :..|.:..||    .|:.|:||.|
  Fly   521 SGLSRLQRLS-----VRGNSLGSLPENIKELRQLHYLNI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 6/25 (24%)
LRR_8 87..147 CDD:290566 20/59 (34%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_8 135..195 CDD:290566 21/59 (36%)
LRR_4 135..175 CDD:289563 17/39 (44%)
leucine-rich repeat 137..160 CDD:275380 10/22 (45%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..209 CDD:275380 5/23 (22%)
leucine-rich repeat 210..231 CDD:275380 5/20 (25%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 2/21 (10%)
leucine-rich repeat 229..252 CDD:275380 6/25 (24%)
LRR_RI <246..433 CDD:238064 56/189 (30%)
LRR_8 251..311 CDD:290566 20/59 (34%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..324 CDD:275380 10/22 (45%)
LRR_8 325..383 CDD:290566 16/58 (28%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
leucine-rich repeat 349..372 CDD:275380 5/23 (22%)
LRR_RI 351..>557 CDD:238064 50/224 (22%)
LRR_8 371..431 CDD:290566 16/61 (26%)
leucine-rich repeat 373..396 CDD:275380 5/22 (23%)
leucine-rich repeat 397..420 CDD:275380 3/22 (14%)
leucine-rich repeat 421..444 CDD:275380 7/26 (27%)
LRR_8 477..536 CDD:290566 18/63 (29%)
leucine-rich repeat 478..502 CDD:275380 8/23 (35%)
leucine-rich repeat 503..526 CDD:275380 4/22 (18%)
Ig <714..761 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.