DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5810 and Toll-4

DIOPT Version :9

Sequence 1:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster


Alignment Length:387 Identity:84/387 - (21%)
Similarity:152/387 - (39%) Gaps:106/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LEC------ELQQIESVCFDGAKNL-------------KRLNFGGNALRVLDSNTFELATQLEEL 140
            |:|      :..|:|..|:.  |||             ..|.|..|.|..|..|:.|....|:.|
  Fly   374 LKCNCSYNRDKSQLEIDCWQ--KNLTTIPSLPVPKKGSSALVFQSNLLAELPDNSLEGYHNLKSL 436

  Fly   141 NLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRD 205
            ::|.|||..|  ::.:..::|..:::.:|::.|||..:...|.|:...|...|:     ..::.|
  Fly   437 DVSYNQLTSL--SVSQLPESLHYLDIRHNKITTLSPQVVEYLYSVNVFNQYGNK-----WSIYCD 494

  Fly   206 QRKHLSEFSAQSNQLVRIPFNIFREI-DHLSLS---------FNPQLRRLHLSAKINE------- 253
            : .||.||.....:|:||..:.|:.| :::.||         |...:.:|:|.|..:|       
  Fly   495 E-YHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNIDQLYLEANEDEIIDAFGP 558

  Fly   254 ---------LEATN--CDLESVELDGRVIGVQLEANPKLHELKISQPQDLE-----HL--YLANT 300
                     :||.|  ..|.|.|.|..:          ||.|....|....     |.  :|.|.
  Fly   559 SDKYFNLKLMEALNHAIWLFSGEFDEII----------LHHLNSPCPYRCSCCFEWHTGEFLINC 613

  Fly   301 NLYRLDFLSKASKLVDLDVTDIVNLADLPKITSAKGL--------ERLSFTYDNLTSNHMDMLPH 357
            ....||...:....:....|..::..::.|:|:.:.|        .:|..:.:.|....:.:|| 
  Fly   614 RNLSLDIYPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQNLLRELPLHLLP- 677

  Fly   358 LKDLNYLEISHEKGKEIFIKDLDEDFFVEEAELNCGQLADLLEFVELPKDTTILEDRLVGDP 419
             :::.||::.:.     .:|.||:               .::.|:|..::.|.:|  |.|:|
  Fly   678 -ENITYLDVRNN-----LLKYLDD---------------GVIAFLEYRENITKIE--LSGNP 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380
LRR_8 87..147 CDD:290566 19/70 (27%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 8/35 (23%)
LRR_8 135..195 CDD:290566 16/59 (27%)
LRR_4 135..175 CDD:289563 10/39 (26%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 3/23 (13%)
leucine-rich repeat 210..231 CDD:275380 7/20 (35%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 2/11 (18%)
leucine-rich repeat 388..408 CDD:275380 5/21 (24%)
LRR_8 412..465 CDD:290566 16/54 (30%)
leucine-rich repeat 412..432 CDD:275378 7/19 (37%)
LRR_4 432..470 CDD:289563 11/39 (28%)
leucine-rich repeat 433..454 CDD:275378 7/22 (32%)
leucine-rich repeat 455..478 CDD:275378 6/22 (27%)
leucine-rich repeat 479..490 CDD:275378 2/15 (13%)
leucine-rich repeat 632..657 CDD:275378 4/24 (17%)
leucine-rich repeat 658..679 CDD:275378 4/22 (18%)
leucine-rich repeat 680..706 CDD:275378 7/45 (16%)
leucine-rich repeat 707..719 CDD:275378 5/12 (42%)
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.