DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and AT1G33610

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_174625.3 Gene:AT1G33610 / 840255 AraportID:AT1G33610 Length:478 Species:Arabidopsis thaliana


Alignment Length:335 Identity:75/335 - (22%)
Similarity:118/335 - (35%) Gaps:112/335 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESD 231
            ||.|||..||.......:..||.:|.||....|.|........|.||.::::.|..|:|:....|
plant   153 LEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPD 217

  Fly   232 LFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSL 296
            :|           ::.:|                ::::|||:|.....|.|:|.....|.....:
plant   218 IF-----------ESMKL----------------LKFLDLSSNEFYGKLPLSIATLAPTLLALQV 255

  Fly   297 DRVNLYGSVTNVDLSDNRVRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQ 361
            .:.||.|::.|.                                 :||..:|..||::.|...|.
plant   256 SQNNLSGAIPNY---------------------------------ISRFNKLEKLDLSKNRFSGV 287

  Fly   362 LPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHG 426
            :|.|:                       ..:.|:..||:|.|.||    ..||.||..|..|: .
plant   288 VPQGF-----------------------VNLTNINNLDLSHNLLT----GQFPDLTVNTIEYL-D 324

  Fly   427 NNWNCFSLRNIMD----------VLIRANGIAYTVDNYDPDFPGEYFHGIACMYRLPEKEGVDSS 481
            .::|.|.|..|..          :.:...||..::|::.|..| .|:|.|             ..
plant   325 LSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEP-LYYHYI-------------DL 375

  Fly   482 SSSEISASVE 491
            |.:|||.|:|
plant   376 SKNEISGSLE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380
LRR_RI 143..407 CDD:238064 50/239 (21%)
leucine-rich repeat 143..166 CDD:275380
LRR_8 166..225 CDD:290566 19/57 (33%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..265 CDD:275380 1/25 (4%)
leucine-rich repeat 266..325 CDD:275380 12/58 (21%)
LRR_8 304..357 CDD:290566 6/52 (12%)
leucine-rich repeat 326..347 CDD:275380 2/20 (10%)
leucine-rich repeat 348..394 CDD:275380 7/45 (16%)
LRR_8 369..428 CDD:290566 13/58 (22%)
LRR_4 393..433 CDD:289563 14/39 (36%)
leucine-rich repeat 395..418 CDD:275380 9/22 (41%)
AT1G33610NP_174625.3 PLN00113 29..>477 CDD:215061 75/335 (22%)
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380 9/22 (41%)
leucine-rich repeat 177..200 CDD:275380 7/22 (32%)
leucine-rich repeat 201..224 CDD:275380 5/33 (15%)
leucine-rich repeat 225..249 CDD:275380 7/23 (30%)
leucine-rich repeat 250..273 CDD:275380 6/55 (11%)
leucine-rich repeat 274..297 CDD:275380 7/45 (16%)
leucine-rich repeat 298..319 CDD:275380 10/24 (42%)
leucine-rich repeat 350..416 CDD:275380 14/50 (28%)
leucine-rich repeat 417..438 CDD:275380
leucine-rich repeat 439..467 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.