DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and AT1G33600

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001321374.1 Gene:AT1G33600 / 840254 AraportID:AT1G33600 Length:478 Species:Arabidopsis thaliana


Alignment Length:390 Identity:87/390 - (22%)
Similarity:138/390 - (35%) Gaps:112/390 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FTN------FPLRLFYTLEVSELDMRG-----------CGIRFIYWENFS---------IGADKL 143
            |||      .|..:....|:.||.:.|           ..:..:|..|..         :|...|
plant   133 FTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANL 197

  Fly   144 VILL---LSDNHI-EVLPTKTFRGAGNLEFIFLNRNKL-GKLQAGAFDNLLKLQYLDLTENRLEA 203
            .|||   ..:|.: |.:| ..|:....|:.:.|:|||. |.|..........|.||||::|.|..
plant   198 KILLSLNFGNNRLSETIP-DIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSG 261

  Fly   204 LAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQY 268
            ......:..|.|..:.|:.|:.:.:.....|:.|.|..:.:.:|.|          .|....|:.
plant   262 TIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFL----------TGPLPAMKN 316

  Fly   269 VD--------------------LSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDN 313
            ||                    ::::|.:..|.|.....|::..|....|.|:|   ..:|||:|
plant   317 VDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPVRPNIY---FYIDLSEN 378

  Fly   314 RVR---ELYFPASEALEHLVLRNNSL-VQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEML 374
            .:.   ..:|..:..|.......|.| ..:..|:...||..||::.|...|::|         |.
plant   379 EISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVP---------MT 434

  Fly   375 VLRNTGQMELPLEALQGMQNLQKLDISGNNL------TEIDPSAFPTLTQLTHFYIHGNNWNCFS 433
            |.:                 ||||::|.|:|      |:...|||.           ||:..|.|
plant   435 VAK-----------------LQKLNLSHNHLCGKLPVTKFPASAFV-----------GNDCLCGS 471

  Fly   434  433
            plant   472  471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/43 (14%)
LRR_RI 143..407 CDD:238064 68/298 (23%)
leucine-rich repeat 143..166 CDD:275380 8/26 (31%)
LRR_8 166..225 CDD:290566 18/59 (31%)
leucine-rich repeat 167..190 CDD:275380 7/23 (30%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
leucine-rich repeat 215..238 CDD:275380 4/22 (18%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 16/81 (20%)
LRR_8 304..357 CDD:290566 13/56 (23%)
leucine-rich repeat 326..347 CDD:275380 4/21 (19%)
leucine-rich repeat 348..394 CDD:275380 8/45 (18%)
LRR_8 369..428 CDD:290566 14/64 (22%)
LRR_4 393..433 CDD:289563 14/45 (31%)
leucine-rich repeat 395..418 CDD:275380 11/28 (39%)
AT1G33600NP_001321374.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.