DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and RLP36

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_188941.1 Gene:RLP36 / 821875 AraportID:AT3G23010 Length:595 Species:Arabidopsis thaliana


Alignment Length:560 Identity:123/560 - (21%)
Similarity:205/560 - (36%) Gaps:162/560 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GTTYEVGDEEHSRTLIFENCTFTNFPLRLFYTLEVSELDMRGCG--IRFIYWENFSIGADKLVIL 146
            |..:..||     |::....:.:...|.|.|.......|:.|..  .||..:.|...|...|.:|
plant    29 GNQFTGGD-----TVLANLTSLSIIDLSLNYFKSSISADLSGLHNLERFSVYNNSFSGPFPLSLL 88

  Fly   147 L--------LSDNHIE--VLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRL 201
            :        ||.||.|  :....|| ....|..:::..|.|..|...:...|:.|:|||::.|..
plant    89 MIPSLVHIDLSQNHFEGPIDFRNTF-SLSRLRVLYVGFNNLDGLIPESISKLVNLEYLDVSHNNF 152

  Fly   202 EALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLR-EVGEYAFRSRGRHHQ 265
                                |.|:....|.:.    :|.||.:..|:|. :|.::.:||    .:
plant   153 --------------------GGQVPRSISKVV----NLTSVDLSYNKLEGQVPDFVWRS----SK 189

  Fly   266 MQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLY--GSVTNVDLSDN-----------RVRE 317
            :.|||||.|                :.||....|.:.  .|:|.::|..|           :|::
plant   190 LDYVDLSYN----------------SFNCFAKSVEVIDGASLTMLNLGSNSVDGPFPKWICKVKD 238

  Fly   318 LY--------FPAS--EALEH------LVLRNNSL--VQLASLSRVPRLRHLDVADNPNLGQLPD 364
            ||        |..|  :.|::      |.||||||  |......:..:||.|||:.|..:|:||.
plant   239 LYALDLSNNHFNGSIPQCLKYSTYFHTLNLRNNSLSGVLPNLFIKDSQLRSLDVSSNNLVGKLPK 303

  Fly   365 G-----------------------W--RTPHLEMLVLRNT---GQMELPLEALQGMQNLQKLDIS 401
            .                       |  ..|:|::|:|.:.   |.:..| .|..|..:::.:|||
plant   304 SLINCERIEFLNVKGNKIMDTFPFWLGSLPYLKVLMLGSNAFYGPVYNP-SAYLGFPSIRIIDIS 367

  Fly   402 GNNLTE----------IDPSAFPTLTQLTHFYIHGN-NWNCFSLRNIMDVLIRANGIAYTVDNYD 455
            .||...          ::.|...:.:.:..|...|| |   ||..:.:|::.:  |:....|...
plant   368 NNNFVGSLPQDYFANWLEMSLVWSGSDIPQFKYMGNVN---FSTYDSIDLVYK--GVETDFDRIF 427

  Fly   456 P-----DFPGEYFHGIACMYRLPEKEGVDSS------SSSEISASVESSPITSSSDPSEVDKLRD 509
            .     ||.|..|.|     .:|...|:.|.      |.:..:.::..| :.:.::...:|..|:
plant   428 EGFNAIDFSGNRFSG-----HIPGSIGLLSELRLLNLSGNAFTGNIPPS-LANITNLESLDLSRN 486

  Fly   510 ELKAVVQ------HFDSKFDLIFSKLAQLNEQIQAFEVLN 543
            .|...:.      .|.|..:..::.|..|..|...|...|
plant   487 NLSGEIPISLGKLSFLSNTNFSYNHLEGLIPQSTQFATQN 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/25 (24%)
LRR_RI 143..407 CDD:238064 80/333 (24%)
leucine-rich repeat 143..166 CDD:275380 9/32 (28%)
LRR_8 166..225 CDD:290566 11/58 (19%)
leucine-rich repeat 167..190 CDD:275380 5/22 (23%)
leucine-rich repeat 191..214 CDD:275380 5/22 (23%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..265 CDD:275380 8/26 (31%)
leucine-rich repeat 266..325 CDD:275380 18/81 (22%)
LRR_8 304..357 CDD:290566 23/81 (28%)
leucine-rich repeat 326..347 CDD:275380 9/28 (32%)
leucine-rich repeat 348..394 CDD:275380 18/73 (25%)
LRR_8 369..428 CDD:290566 17/72 (24%)
LRR_4 393..433 CDD:289563 10/50 (20%)
leucine-rich repeat 395..418 CDD:275380 6/32 (19%)
RLP36NP_188941.1 LRR_RI <16..201 CDD:238064 49/221 (22%)
leucine-rich repeat 22..44 CDD:275380 4/19 (21%)
leucine-rich repeat 45..68 CDD:275380 5/22 (23%)
leucine-rich repeat 69..92 CDD:275380 6/22 (27%)
leucine-rich repeat 93..117 CDD:275380 7/24 (29%)
LRR_8 116..176 CDD:290566 17/83 (20%)
leucine-rich repeat 118..141 CDD:275380 5/22 (23%)
leucine-rich repeat 142..165 CDD:275380 8/46 (17%)
leucine-rich repeat 166..189 CDD:275380 8/26 (31%)
leucine-rich repeat 239..262 CDD:275380 5/22 (23%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
LRR_8 264..321 CDD:290566 17/56 (30%)
leucine-rich repeat 287..310 CDD:275380 9/22 (41%)
leucine-rich repeat 311..334 CDD:275380 1/22 (5%)
leucine-rich repeat 361..403 CDD:275380 7/41 (17%)
leucine-rich repeat 404..477 CDD:275380 16/83 (19%)
leucine-rich repeat 478..499 CDD:275380 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.