DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and Toll-6

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:530 Identity:122/530 - (23%)
Similarity:195/530 - (36%) Gaps:162/530 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DADADVDSGSSRIVLVSSLEGHCQTEGKVTSCRGFEFAGEDEKATFDLPTEVRIAEDGTTYEVGD 91
            |...:..:||:.  ..|:.|...::....|||            :.||             |..|
  Fly   246 DRSKEPTNGSTE--STSTTESAKKSSSSSTSC------------SLDL-------------EYLD 283

  Fly    92 EEHSRTLIFENCTFTNFPLRLFYTL-EVSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEV 155
            ..|:        .|...|...|.|| .:..|.:...||..|..:..| |...|.||.||.|.|..
  Fly   284 VSHN--------DFVVLPANGFGTLRRLRVLSVNNNGISMIADKALS-GLKNLQILNLSSNKIVA 339

  Fly   156 LPTKTF-RGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAAD--VFAGLKSLRH 217
            |||:.| ..|..::.::|..|.:..|....|.||.:||.|||:.|::.:...|  .|.||..|..
  Fly   340 LPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVL 404

  Fly   218 VGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGR-------HHQMQYVD-LSNN 274
            :.|:.|:||.:|.::|:....|..:.:::|:|..:....|.....       |::::|:| .:.|
  Fly   405 LNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALN 469

  Fly   275 PELVVLLLNINATNLTA------RNCS-LDRVNLYGS--------------VTNVDLSDNRVR-- 316
            ...|:.||:::...|..      |||| |..:||.|:              :..|||.:|.:.  
  Fly   470 GLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVM 534

  Fly   317 ---------ELY----------------------------------------FPASEALEHLVLR 332
                     .||                                        |..:.:::.:.|.
  Fly   535 EDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLD 599

  Fly   333 NNSLVQLASL-SRVPRLRHLDVADNP----NLGQLPD--GWRTPHLEML-VLRNTGQMELPLEAL 389
            .|.|..:..| |.:|.|..|:::||.    :.|.:|.  .|...|...| .|.|...::..|:  
  Fly   600 GNELNDINGLFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLHKNRLSSLSNRFGLDSELK-- 662

  Fly   390 QGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNY 454
                 ||.||:|.|.|..|.||:.|                     |.:::|...:.:..|||  
  Fly   663 -----LQTLDVSFNQLQRIGPSSIP---------------------NSIELLFLNDNLITTVD-- 699

  Fly   455 DPDFPGEYFH 464
                |..:.|
  Fly   700 ----PDTFMH 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/23 (26%)
LRR_RI 143..407 CDD:238064 87/354 (25%)
leucine-rich repeat 143..166 CDD:275380 12/23 (52%)
LRR_8 166..225 CDD:290566 19/60 (32%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 10/24 (42%)
leucine-rich repeat 215..238 CDD:275380 7/22 (32%)
leucine-rich repeat 239..265 CDD:275380 5/32 (16%)
leucine-rich repeat 266..325 CDD:275380 22/131 (17%)
LRR_8 304..357 CDD:290566 16/118 (14%)
leucine-rich repeat 326..347 CDD:275380 5/21 (24%)
leucine-rich repeat 348..394 CDD:275380 12/52 (23%)
LRR_8 369..428 CDD:290566 16/59 (27%)
LRR_4 393..433 CDD:289563 11/39 (28%)
leucine-rich repeat 395..418 CDD:275380 11/22 (50%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 8/45 (18%)
leucine-rich repeat 229..249 CDD:275380 1/2 (50%)
LRR_RI 278..468 CDD:238064 58/211 (27%)
leucine-rich repeat 279..302 CDD:275380 9/43 (21%)
LRR_8 301..386 CDD:290566 30/85 (35%)
leucine-rich repeat 303..326 CDD:275380 6/23 (26%)
leucine-rich repeat 327..350 CDD:275380 11/22 (50%)
LRR 350..729 CDD:227223 86/390 (22%)
leucine-rich repeat 352..375 CDD:275380 6/22 (27%)
leucine-rich repeat 376..401 CDD:275380 10/24 (42%)
LRR_RI <401..626 CDD:238064 44/224 (20%)
leucine-rich repeat 402..425 CDD:275380 7/22 (32%)
leucine-rich repeat 426..449 CDD:275380 4/22 (18%)
leucine-rich repeat 450..473 CDD:275380 4/22 (18%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
leucine-rich repeat 498..518 CDD:275380 4/19 (21%)
leucine-rich repeat 521..544 CDD:275380 4/22 (18%)
leucine-rich repeat 545..566 CDD:275380 2/20 (10%)
leucine-rich repeat 569..592 CDD:275380 1/22 (5%)
leucine-rich repeat 593..615 CDD:275380 5/21 (24%)
leucine-rich repeat 616..637 CDD:275380 6/20 (30%)
leucine-rich repeat 638..662 CDD:275380 5/23 (22%)
leucine-rich repeat 663..684 CDD:275380 11/41 (27%)
leucine-rich repeat 685..708 CDD:275380 6/27 (22%)
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.