DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and trn

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:436 Identity:104/436 - (23%)
Similarity:166/436 - (38%) Gaps:105/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 KLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLG------------------------KLQA 182
            :|..|.||.||:..:|.:||.....|:.:.||.||:|                        :|..
  Fly    83 ELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQ 147

  Fly   183 GAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTI-ESDLFAHNPDLLSVAMQN 246
            |.|..|||::.|:|.|||:..|....|.||..||.:.|..|.|||: :..:|...|.|..:.:..
  Fly   148 GTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGM 212

  Fly   247 NRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLS 311
            |.|:.:...||:           ||..       |..:.....:.||.|.|.......:..:|||
  Fly   213 NTLQSIQADAFQ-----------DLKG-------LTRLELKGASLRNISHDSFLGLQELRILDLS 259

  Fly   312 DNRVRELYFPA-----SEALEHLVLRNN--SLVQLASLSRVPRLRHLDV--------------AD 355
            |||:..:  |:     ...||.|.|..|  .::...:...:.:|:.|:|              :|
  Fly   260 DNRLDRI--PSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSD 322

  Fly   356 NPNLGQLPDGWRTPHLEMLVL-RNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQL 419
            |.|            ||.|.| .|...:|:...||.|:..|:.:.:..|.||.:....|| ...|
  Fly   323 NGN------------LEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFP-WKDL 374

  Fly   420 THFYIHGNNWNC----FSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHG----------IACMY 470
            ....:..|..:|    ..|.|:   |:..|.....|.....:|| |...|          :.|.:
  Fly   375 QTLDLSENPLSCDCRVMWLHNL---LVAKNASQDDVSELLCEFP-ERLRGESLRHLNPAMMGCTH 435

  Fly   471 RLPEKEGVDSSSSSEISASVESSPITSSSDPSEVDKLRDELKAVVQ 516
            ..|.|:.:       |.|.:..|..|.::....:.:.|.:::..::
  Fly   436 ADPRKQAL-------IGALLVGSAATITALALVLYRCRHKIRETIK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 104/436 (24%)
LRR_RI 143..407 CDD:238064 81/310 (26%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
LRR_8 166..225 CDD:290566 25/82 (30%)
leucine-rich repeat 167..190 CDD:275380 10/46 (22%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 8/23 (35%)
leucine-rich repeat 239..265 CDD:275380 5/25 (20%)
leucine-rich repeat 266..325 CDD:275380 14/63 (22%)
LRR_8 304..357 CDD:290566 16/73 (22%)
leucine-rich repeat 326..347 CDD:275380 5/22 (23%)
leucine-rich repeat 348..394 CDD:275380 15/60 (25%)
LRR_8 369..428 CDD:290566 16/59 (27%)
LRR_4 393..433 CDD:289563 9/43 (21%)
leucine-rich repeat 395..418 CDD:275380 6/22 (27%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566 15/58 (26%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_RI 129..421 CDD:238064 80/328 (24%)
LRR_8 132..190 CDD:290566 19/57 (33%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 18/77 (23%)
leucine-rich repeat 205..228 CDD:275380 7/33 (21%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..308 CDD:290566 15/57 (26%)
leucine-rich repeat 253..276 CDD:275380 7/24 (29%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
LRR_8 325..384 CDD:290566 18/71 (25%)
leucine-rich repeat 326..350 CDD:275380 9/23 (39%)
leucine-rich repeat 351..373 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.