DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and ltl

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster


Alignment Length:405 Identity:100/405 - (24%)
Similarity:160/405 - (39%) Gaps:101/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGA--------------------- 164
            ||:..|.||.:..|:|. |..::..|:|..|.|    |:..||:                     
  Fly   138 LDIGRCKIRAVQQEDFR-GIQRVTNLILVSNII----TRLDRGSFPKSLLILHLGRNQLESLNGS 197

  Fly   165 ----GNLEFIFLNRNKLGKLQAGAFDNLL---KLQYLDLTENRLEALAADVFAGLKSLRHVGLAG 222
                .|||.:|:|.|.:..|.    |.|.   :|:.|....||||.|.|:: ||:.||..|.:..
  Fly   198 LHDLHNLESLFINANNITSLD----DELPDGGQLRLLMAHNNRLERLPANM-AGMHSLETVHIHC 257

  Fly   223 NQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQ----YVDLSNNPELVVL-LL 282
            |||.:.:. :..:..:|..|...||.|..:.:..|.|..:...:|    ::...|:..|.:| |.
  Fly   258 NQLRSFDR-VLRNAVNLSEVMADNNELEYLAQDEFASCSKVETLQMGCNHIKSLNSSLLPILKLK 321

  Fly   283 NINATNLTARNCSLDRVNLYGSVTNVDLSDNRVRELYFPASEALEHLV-----LRNNSLVQL-AS 341
            |.|.:.......|:..::...|:..:.||.||::.| .|....::.|:     |.||.:..| .:
  Fly   322 NANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRL-LPDPRGVQELMLVNLDLDNNRIDSLNGA 385

  Fly   342 LSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLT 406
            |:.:..||.|::|.|          |..||::      |..:       ||..|..||::||.|.
  Fly   386 LAGLGNLRILNLAGN----------RLEHLQV------GDFD-------GMIRLDILDLTGNQLA 427

  Fly   407 EIDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACMYR 471
            |:.|.....|..|....:..||                      :...:.||.|   ..:.|...
  Fly   428 ELKPLEMTLLPSLKILKVAYNN----------------------ITKLEQDFKG---LPVLCQAN 467

  Fly   472 LPEKEGVDSSSSSEI 486
            |...:  .|:.|||:
  Fly   468 LTNNQ--ISTISSEL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 8/20 (40%)
LRR_RI 143..407 CDD:238064 77/302 (25%)
leucine-rich repeat 143..166 CDD:275380 7/47 (15%)
LRR_8 166..225 CDD:290566 23/61 (38%)
leucine-rich repeat 167..190 CDD:275380 8/25 (32%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..265 CDD:275380 7/25 (28%)
leucine-rich repeat 266..325 CDD:275380 15/63 (24%)
LRR_8 304..357 CDD:290566 17/58 (29%)
leucine-rich repeat 326..347 CDD:275380 6/26 (23%)
leucine-rich repeat 348..394 CDD:275380 11/45 (24%)
LRR_8 369..428 CDD:290566 15/58 (26%)
LRR_4 393..433 CDD:289563 12/39 (31%)
leucine-rich repeat 395..418 CDD:275380 9/22 (41%)
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380
LRR_8 86..145 CDD:290566 3/6 (50%)
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380 8/20 (40%)
LRR_8 158..214 CDD:290566 13/59 (22%)
leucine-rich repeat 159..180 CDD:275380 7/24 (29%)
leucine-rich repeat 181..203 CDD:275380 0/21 (0%)
leucine-rich repeat 204..226 CDD:275380 8/25 (32%)
LRR_RI 226..451 CDD:238064 67/272 (25%)
leucine-rich repeat 227..249 CDD:275380 10/22 (45%)
leucine-rich repeat 250..272 CDD:275380 5/22 (23%)
leucine-rich repeat 273..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..315 CDD:275380 2/17 (12%)
LRR_8 319..402 CDD:290566 22/93 (24%)
leucine-rich repeat 320..335 CDD:275378 3/14 (21%)
leucine-rich repeat 344..366 CDD:275380 6/22 (27%)
leucine-rich repeat 367..391 CDD:275380 6/23 (26%)
LRR_8 369..426 CDD:290566 21/79 (27%)
leucine-rich repeat 392..415 CDD:275380 11/45 (24%)
leucine-rich repeat 416..439 CDD:275380 9/22 (41%)
LRR_8 438..>479 CDD:290566 10/67 (15%)
leucine-rich repeat 440..462 CDD:275380 6/46 (13%)
leucine-rich repeat 463..483 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.