DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and CG4781

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:407 Identity:92/407 - (22%)
Similarity:148/407 - (36%) Gaps:119/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NCTFTNF---PLRLFYTLEVSELDMRGCGIRFIYWENFS----IGADKLVILLLSDNHIEVLPTK 159
            :|::.::   .|.|...|.:..||:.        |....    ..:|.|..|.|..|:|..|.:.
  Fly    69 DCSYKDYKVADLSLLLPLYIDSLDLS--------WNALDSVPIFTSDSLHQLNLRHNNISQLVSG 125

  Fly   160 TFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQ 224
            .|:...:|..::|..|.:|||::|:||.|..||.|||..|.|..|...:||.|..|..:.::.|:
  Fly   126 NFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNR 190

  Fly   225 LTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLS----NNPELVVLLLNIN 285
                                   |..|.|...:...|.:.::..:.|.    |:..|.|   |..
  Fly   191 -----------------------RFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPV---NAP 229

  Fly   286 ATNLTARNCSLDRV--NLYGSVTNVDLSDN--------------RVRELYFPASEALEHLVLRNN 334
            ...|:.|...|.|:  .|..::..:|:|||              :||:|:......|:.:|.  |
  Fly   230 LKELSLRRNQLKRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVA--N 292

  Fly   335 SLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQM-ELPLEALQGMQN---- 394
            ||.            |:||                 ||.|..:|:.|: .|..||...:..    
  Fly   293 SLT------------HVDV-----------------LETLSFQNSRQLSHLDAEAFGPIMTTPTK 328

  Fly   395 ---LQKLDISGNNLTEIDPSAFPTLTQLTHFYIHG------------------NNWNCFSLRNIM 438
               |:.|...|..|...:.:..|..|||....::|                  .|..|:....|.
  Fly   329 KRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWLKQLPVQTNGRCYKPARIR 393

  Fly   439 DVLI-RANGIAYTVDNY 454
            .:|: .|.|.|::.|.:
  Fly   394 GMLVTSARGDAFSCDTW 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 3/27 (11%)
LRR_RI 143..407 CDD:238064 71/291 (24%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
LRR_8 166..225 CDD:290566 23/58 (40%)
leucine-rich repeat 167..190 CDD:275380 10/22 (45%)
leucine-rich repeat 191..214 CDD:275380 11/22 (50%)
leucine-rich repeat 215..238 CDD:275380 2/22 (9%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 17/78 (22%)
LRR_8 304..357 CDD:290566 15/66 (23%)
leucine-rich repeat 326..347 CDD:275380 5/20 (25%)
leucine-rich repeat 348..394 CDD:275380 11/46 (24%)
LRR_8 369..428 CDD:290566 17/84 (20%)
LRR_4 393..433 CDD:289563 11/64 (17%)
leucine-rich repeat 395..418 CDD:275380 5/22 (23%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 3/25 (12%)
LRR_8 108..167 CDD:290566 23/58 (40%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR_RI <121..>261 CDD:238064 43/165 (26%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 11/22 (50%)
leucine-rich repeat 181..208 CDD:275380 6/49 (12%)
leucine-rich repeat 230..253 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 4/19 (21%)
leucine-rich repeat 275..299 CDD:275380 9/37 (24%)
leucine-rich repeat 300..319 CDD:275380 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.