DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and 18w

DIOPT Version :10

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster


Alignment Length:679 Identity:148/679 - (21%)
Similarity:232/679 - (34%) Gaps:266/679 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TFDLPTEVRIAEDGTTYEVG----------DEEHSRTLIFENCTFTNFPLRLFYTLE-VSELDMR 124
            |.|:...||..|.||...:.          |.:.|:.|:..    :.....||..|: :|||.:.
  Fly    38 TMDIRCSVRALESGTGTPLDLQVAEAAGRLDLQCSQELLHA----SELAPGLFRQLQKLSELRID 98

  Fly   125 GCGIRFI---------------------YW----------ENFSIGADKLVILLLSDNHIEVLPT 158
            .|.::.:                     .|          ::|. |..:|..|.|.||:|..||.
  Fly    99 ACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQSFQ-GLKELSELHLGDNNIRQLPE 162

  Fly   159 KTFRGAGNLEFIFLNRNK------LG---KLQAG-AFDN-------------------------- 187
            ..:....:|:.:.|.:|:      ||   ||.|| |..|                          
  Fly   163 GVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPD 227

  Fly   188 ------LLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQN 246
                  |.:||.|.|..|.:..||.:..|||.|||.:.::.|.|.::.|:.||.|.:|..:.:|.
  Fly   228 AWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQG 292

  Fly   247 NRLREVGEYAFRSRGRHH---QMQYVDLSNNP---------------ELVVLLLNINATN----- 288
            |.|.|:      .:|..|   |:..:|||.|.               .|:||.|:.||..     
  Fly   293 NDLYEL------PKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSK 351

  Fly   289 ----------LTARNCSLDRVN------LYGSVTNVDLSDNRVREL---YFPASEALEHLVLRNN 334
                      |..||.|:..:.      || ::..::|::||:..|   .|.....|..|.|.||
  Fly   352 TFKELYFLQILDMRNNSIGHIEEGAFLPLY-NLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNN 415

  Fly   335 --SLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQK 397
              |:|:..:......|:.||::.| .|.::|                       ||:|.:..|:.
  Fly   416 LVSIVESQAFRNCSDLKELDLSSN-QLTEVP-----------------------EAVQDLSMLKT 456

  Fly   398 LDISGNNLTEIDPSAFPTLTQLTHFYIHGN----------------------------------- 427
            ||:..|.::|...:.|..|.|||...:..|                                   
  Fly   457 LDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFD 521

  Fly   428 -NWNCFSLRNIMDVLIRANGIAYTVDN-----------------YDP------DFPGEYFHGIAC 468
             |....::|...:.|...|||..|:.:                 :.|      |..|.|...:..
  Fly   522 KNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGN 586

  Fly   469 MYRLPEKEGVDSSSSS-----EISA-SVESSPITSSSDPSEVDKLRDELKAVVQHFDSKFDLIFS 527
            .|:|.|:..|.:..:|     ||.| ||.:|                            .:|:| 
  Fly   587 YYKLQEEIRVTTLDASHNRITEIGAMSVPNS----------------------------IELLF- 622

  Fly   528 KLAQLNE----QIQAFEVLNKTVWSQVTL 552
                :|.    ||||...::||..::|.|
  Fly   623 ----INNNIIGQIQANTFVDKTRLARVDL 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 LRR 107..>410 CDD:443914 99/420 (24%)
leucine-rich repeat 118..142 CDD:275380 7/54 (13%)
leucine-rich repeat 143..166 CDD:275380 8/22 (36%)
leucine-rich repeat 167..190 CDD:275380 12/64 (19%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..265 CDD:275380 7/28 (25%)
leucine-rich repeat 266..325 CDD:275380 21/97 (22%)
leucine-rich repeat 326..347 CDD:275380 7/22 (32%)
leucine-rich repeat 348..394 CDD:275380 9/45 (20%)
leucine-rich repeat 395..418 CDD:275380 7/22 (32%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 6/28 (21%)
leucine-rich repeat 92..115 CDD:275380 4/22 (18%)
LRR_8 115..181 CDD:404697 14/66 (21%)
leucine-rich repeat 116..146 CDD:275380 3/30 (10%)
leucine-rich repeat 147..170 CDD:275380 8/22 (36%)
leucine-rich repeat 171..201 CDD:275380 10/29 (34%)
LRR 210..592 CDD:443914 89/412 (22%)
leucine-rich repeat 212..236 CDD:275380 1/23 (4%)
leucine-rich repeat 237..260 CDD:275380 10/22 (45%)
leucine-rich repeat 261..284 CDD:275380 8/22 (36%)
leucine-rich repeat 285..308 CDD:275380 7/28 (25%)
leucine-rich repeat 309..334 CDD:275380 4/24 (17%)
leucine-rich repeat 335..358 CDD:275380 6/22 (27%)
leucine-rich repeat 359..382 CDD:275380 6/23 (26%)
leucine-rich repeat 383..406 CDD:275380 5/22 (23%)
leucine-rich repeat 407..430 CDD:275380 7/22 (32%)
leucine-rich repeat 431..451 CDD:275380 9/43 (21%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
leucine-rich repeat 478..499 CDD:275380 3/20 (15%)
leucine-rich repeat 502..525 CDD:275380 1/22 (5%)
leucine-rich repeat 526..548 CDD:275380 6/21 (29%)
leucine-rich repeat 590..617 CDD:275380 9/26 (35%)
leucine-rich repeat 618..641 CDD:275380 8/27 (30%)
leucine-rich repeat 642..689 CDD:275380 2/6 (33%)
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.