DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and conv

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster


Alignment Length:645 Identity:136/645 - (21%)
Similarity:233/645 - (36%) Gaps:210/645 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HSRTLIFENCTFTNFP-LRLFYTLEVSELDMRGCGIRFIY------WENFSIGA----------- 140
            |...|  ||.....|. ||....|::|...::....:.|.      |.|.|..|           
  Fly   206 HGNQL--ENLKRNQFKNLRELEVLDISHNQIKKLEAQHIADLTKLGWCNVSHNALSELSRGTFAR 268

  Fly   141 -DKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEAL 204
             ..|.:|.||.|.|..|...:|||...|..:||:.|.|..:..|.|.::.::..:||..|||:.:
  Fly   269 NSVLKVLHLSHNQIARLDANSFRGMRFLRRLFLSDNVLTDIGRGTFGSIARIGTIDLARNRLKKI 333

  Fly   205 AADVFAGLKSLRHVGLAGNQLTTIESDLF----------AHNP-DLLSVA------------MQN 246
            ...:|..:..:..:.||.|.:|.||.:.|          :||. :|:..|            :.:
  Fly   334 EFQMFTQMNYVELLDLAENNITKIEKNSFKDIYQAIINVSHNALELIETAAFENCVNITVLDLSH 398

  Fly   247 NRL-----REVGEYAFRSRGRHHQMQYVDLSNNPELVV------LLLNINATNLT--ARNCSLDR 298
            |||     |...|..|.:   :.|:.|.:|:|..::.:      .:||.:..::|  .:||....
  Fly   399 NRLANFSRRSFDETTFAT---YFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFPKL 460

  Fly   299 VNLYG--------------------SVTNVDLSDNRVREL---YFPASEALEHLVLRNNSLVQL- 339
            ..|:.                    |:.::|||.|.:||:   .|.....|..:.|.:|.||.: 
  Fly   461 YELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVV 525

  Fly   340 -ASLSRVPRLRHLDVADNP-------------------NLGQLPDG-WRTPH------------- 370
             .||:::..||.|.:.:|.                   .|..:|.| |...:             
  Fly   526 RGSLAKLTSLRQLYLNNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLG 590

  Fly   371 -------------LEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHF 422
                         ::.|.|:|.|..:.|.:|:..|..||.|.:..||:|.::.|||..|..|...
  Fly   591 DTLNGESFTGLLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFEL 655

  Fly   423 YIHGNNWNCFSLR------NIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACMYRLPEKEGVDSS 481
            .::||.....|.|      .::.:.:.:||| .|:.|       :.|.|      ||....:|.|
  Fly   656 NLYGNQVKDISKRAFEGLLQLLTLNLSSNGI-QTLQN-------DIFVG------LPSLRNLDLS 706

  Fly   482 SSS------------EISASVES--------SPITSSSDPSEV---------------------- 504
            .:|            :...|:|:        |.:|..:.||..                      
  Fly   707 FNSLTKLDNKTNGVLDDLLSLETLDLSHNRISFVTKKTFPSHQYIPYNLRNLNLSYNLMPILTYD 771

  Fly   505 ---------------DKLRDELKAVVQHFDS--KFDLIFSKLAQLNEQIQAFEVLNKTVW 547
                           :::.|..:.|:.:|.|  ..|:.:::|:.|..:...|::.....|
  Fly   772 ITFGTKKLVRLDVSHNQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFDLPQNLSW 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/41 (15%)
LRR_RI 143..407 CDD:238064 85/370 (23%)
leucine-rich repeat 143..166 CDD:275380 10/22 (45%)
LRR_8 166..225 CDD:290566 16/58 (28%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 6/22 (27%)
leucine-rich repeat 215..238 CDD:275380 9/33 (27%)
leucine-rich repeat 239..265 CDD:275380 8/42 (19%)
leucine-rich repeat 266..325 CDD:275380 17/89 (19%)
LRR_8 304..357 CDD:290566 18/57 (32%)
leucine-rich repeat 326..347 CDD:275380 7/22 (32%)
leucine-rich repeat 348..394 CDD:275380 15/91 (16%)
LRR_8 369..428 CDD:290566 19/84 (23%)
LRR_4 393..433 CDD:289563 13/39 (33%)
leucine-rich repeat 395..418 CDD:275380 10/22 (45%)
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566 13/53 (25%)
leucine-rich repeat 200..223 CDD:275380 6/18 (33%)
LRR_RI 201..545 CDD:238064 83/343 (24%)
leucine-rich repeat 224..271 CDD:275380 7/46 (15%)
LRR_8 245..306 CDD:290566 18/60 (30%)
leucine-rich repeat 272..295 CDD:275380 10/22 (45%)
LRR_8 296..354 CDD:290566 16/57 (28%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 322..401 CDD:290566 18/78 (23%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
leucine-rich repeat 344..367 CDD:275380 7/22 (32%)
leucine-rich repeat 371..390 CDD:275380 4/18 (22%)
leucine-rich repeat 391..414 CDD:275380 5/22 (23%)
leucine-rich repeat 416..438 CDD:275380 4/24 (17%)
LRR_8 437..495 CDD:290566 10/57 (18%)
leucine-rich repeat 439..462 CDD:275380 5/22 (23%)
leucine-rich repeat 463..486 CDD:275380 1/22 (5%)
LRR_RI 486..738 CDD:238064 59/265 (22%)
LRR_8 486..545 CDD:290566 19/58 (33%)
leucine-rich repeat 487..510 CDD:275380 7/22 (32%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
leucine-rich repeat 535..554 CDD:275380 4/18 (22%)
LRR_8 554..614 CDD:290566 7/59 (12%)
leucine-rich repeat 555..578 CDD:275380 4/22 (18%)
leucine-rich repeat 579..603 CDD:275380 0/23 (0%)
leucine-rich repeat 604..627 CDD:275380 7/22 (32%)
LRR_8 626..710 CDD:290566 26/97 (27%)
leucine-rich repeat 628..649 CDD:275380 9/20 (45%)
leucine-rich repeat 652..672 CDD:275380 5/19 (26%)
LRR_8 698..765 CDD:290566 10/66 (15%)
leucine-rich repeat 700..726 CDD:275380 3/25 (12%)
leucine-rich repeat 727..745 CDD:275380 3/17 (18%)
LRR_8 777..839 CDD:290566 9/55 (16%)
leucine-rich repeat 779..802 CDD:275380 3/22 (14%)
leucine-rich repeat 829..852 CDD:275380 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.