DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and CG5096

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:355 Identity:85/355 - (23%)
Similarity:153/355 - (43%) Gaps:79/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 WENFSIGADKLVILLLSDNH---IEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYL 194
            ||:.:.|......:.|..|:   :.:||..      ::|.::|..|::..:..|||.||.:|..|
  Fly    74 WEDLTNGNVVFKTINLEHNNLTSVPILPKY------DVENLYLANNQIDSISVGAFQNLTELVTL 132

  Fly   195 DLTENRL--EALAADVFAG---------LKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNN- 247
            ||:.|||  :.|..|||.|         |::|:.:.|..|.|.::::|||.|.|.:..:.:.:| 
  Fly   133 DLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNS 197

  Fly   248 -----RLREVGEYAFRSRGRHHQMQYVDLSNNPELVV-----LLLNINATNLTARNCSLDRVNLY 302
                 :|.|......:|. :...:.|:::.:.|:.::     |.:.|.|.||..:   |.:...|
  Fly   198 FHVIDQLSETAISGLQSL-KILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQ---LPKALKY 258

  Fly   303 G-SVTNVDLSDNRVREL----YFPASEALEHLVLR-NNSLVQL--ASLSRVPRLRHLDVADNPNL 359
            . ::|::.|::|.:..|    .||....|.||.:. .:.|.::  .:.|.:..|..|.::||..|
  Fly   259 ATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLL 323

  Fly   360 GQLPDGWRT-----------PHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAF 413
            .::.:...:           |.||.:.|.|.....||.|.|.....|:.||              
  Fly   324 NEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALD-------------- 374

  Fly   414 PTLTQLTHFYIHGNNWNCFSLRN-IMDVLI 442
                      :..|.|||....: :::|||
  Fly   375 ----------LRFNPWNCDESNDFLINVLI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 3/8 (38%)
LRR_RI 143..407 CDD:238064 75/307 (24%)
leucine-rich repeat 143..166 CDD:275380 4/25 (16%)
LRR_8 166..225 CDD:290566 24/69 (35%)
leucine-rich repeat 167..190 CDD:275380 8/22 (36%)
leucine-rich repeat 191..214 CDD:275380 13/33 (39%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..265 CDD:275380 4/31 (13%)
leucine-rich repeat 266..325 CDD:275380 15/68 (22%)
LRR_8 304..357 CDD:290566 14/59 (24%)
leucine-rich repeat 326..347 CDD:275380 5/23 (22%)
leucine-rich repeat 348..394 CDD:275380 14/56 (25%)
LRR_8 369..428 CDD:290566 12/58 (21%)
LRR_4 393..433 CDD:289563 7/39 (18%)
leucine-rich repeat 395..418 CDD:275380 3/22 (14%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 78/337 (23%)
leucine-rich repeat 85..104 CDD:275380 4/24 (17%)
LRR_8 105..174 CDD:290566 24/68 (35%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 13/33 (39%)
LRR_8 163..222 CDD:290566 13/59 (22%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 3/25 (12%)
leucine-rich repeat 215..238 CDD:275380 2/23 (9%)
leucine-rich repeat 239..261 CDD:275380 7/24 (29%)
LRR_8 260..322 CDD:290566 15/61 (25%)
leucine-rich repeat 262..286 CDD:275380 6/23 (26%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 8/22 (36%)
leucine-rich repeat 370..388 CDD:275380 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.