Sequence 1: | NP_650951.1 | Gene: | cDIP / 42512 | FlyBaseID: | FBgn0038865 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
Alignment Length: | 278 | Identity: | 75/278 - (26%) |
---|---|---|---|
Similarity: | 117/278 - (42%) | Gaps: | 55/278 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 MRGCGIRFIYWENFSIGAD---------------KLVILLLSDNHIEVLPTKTFRGAG--NLEFI 170
Fly 171 FLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAH 235
Fly 236 NPDLLSVAMQNNRLREVGEYAF------------RSRGRH-HQMQYVDLSNNPELVVLLLNINAT 287
Fly 288 NLTARNCSLDRVNLYGSVTNVDLSDNRV-RELYFPASEALEHLVLRNN--SLVQLASLSRVPRL- 348
Fly 349 ---RHLDVADNPNLGQLP 363 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cDIP | NP_650951.1 | leucine-rich repeat | 118..142 | CDD:275380 | 6/33 (18%) |
LRR_RI | 143..407 | CDD:238064 | 69/243 (28%) | ||
leucine-rich repeat | 143..166 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 166..225 | CDD:290566 | 22/58 (38%) | ||
leucine-rich repeat | 167..190 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 191..214 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 239..265 | CDD:275380 | 10/38 (26%) | ||
leucine-rich repeat | 266..325 | CDD:275380 | 15/59 (25%) | ||
LRR_8 | 304..357 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 326..347 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 348..394 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 369..428 | CDD:290566 | |||
LRR_4 | 393..433 | CDD:289563 | |||
leucine-rich repeat | 395..418 | CDD:275380 | |||
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 29/83 (35%) |
leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 99..159 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 6/22 (27%) | ||
LRR | 122..145 | CDD:197688 | 9/22 (41%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 148..207 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 197..>229 | CDD:290566 | 8/34 (24%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 5/25 (20%) | ||
LRRCT | 229..277 | CDD:214507 | 15/61 (25%) | ||
Ig | 296..376 | CDD:143165 | 2/5 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453740 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |